(data stored in SCRATCH zone)

EMBL: CP002505.PE305

CP002505.PE305       Location/Qualifiers
FT   CDS             complement(349459..350454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0308"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ypb:YPTS_3916
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71938"
FT                   /db_xref="GOA:A0A0H3F4U8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4U8"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADW71938.1"
FT                   /translation="MFESFRPLRGASNPHIQTLLPRLVRRHAKLKPHWQRLDTPDGDFL
FT                   DLAWTEDPEQARHKPRMILFHGLEGSFFSPYAHGLLQAWKDKGWLGVVMHFRGCSGEPN
FT                   KLLRIYHSGETEDARFFIHWLNETYGEVPTGAVGVSLGGNMLACYLGQEGETCTLSAAV
FT                   VVSAPLMLEPCAYRLEQGSSRIYQRYLLDQLKGNASRKLAKYPGTLPVTLEQLKAMRYL
FT                   REFDDAITSKAHGFTDALDYYRRCSGLPLLAQIRTPLLIIHAKDDPFMTPEVIPKAEDL
FT                   PDCVEYQLTEHGGHVGFVSGSLRHPQMWLEQRIPAWIAPYLENKTKETTE"
     MFESFRPLRG ASNPHIQTLL PRLVRRHAKL KPHWQRLDTP DGDFLDLAWT EDPEQARHKP        60
     RMILFHGLEG SFFSPYAHGL LQAWKDKGWL GVVMHFRGCS GEPNKLLRIY HSGETEDARF       120
     FIHWLNETYG EVPTGAVGVS LGGNMLACYL GQEGETCTLS AAVVVSAPLM LEPCAYRLEQ       180
     GSSRIYQRYL LDQLKGNASR KLAKYPGTLP VTLEQLKAMR YLREFDDAIT SKAHGFTDAL       240
     DYYRRCSGLP LLAQIRTPLL IIHAKDDPFM TPEVIPKAED LPDCVEYQLT EHGGHVGFVS       300
     GSLRHPQMWL EQRIPAWIAP YLENKTKETT E                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page