(data stored in SCRATCH zone)

EMBL: CP002505.PE315

CP002505.PE315       Location/Qualifiers
FT   CDS             359140..359532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0318"
FT                   /product="sulfur relay protein TusD/DsrE"
FT                   /note="KEGG: ypb:YPTS_3900 sulfur transfer complex subunit
FT                   TusD; TIGRFAM: sulfur relay protein TusD/DsrE; PFAM: DsrE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71948"
FT                   /db_xref="GOA:A0A0H3F4V8"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017463"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4V8"
FT                   /inference="protein motif:TFAM:TIGR03012"
FT                   /protein_id="ADW71948.1"
FT                   /translation="MKLRYCLLVTGPAYGTQQASAAYQFALALIASGHHLDSVFFYREG
FT                   VLNGNLLSAPASDEFDLVRSWQRMAADYQVALNVCVAAALRRGVIDETEAHNQGHGQTN
FT                   LQPGFTLTGLGSLAEASLTCDRLVQF"
     MKLRYCLLVT GPAYGTQQAS AAYQFALALI ASGHHLDSVF FYREGVLNGN LLSAPASDEF        60
     DLVRSWQRMA ADYQVALNVC VAAALRRGVI DETEAHNQGH GQTNLQPGFT LTGLGSLAEA       120
     SLTCDRLVQF                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page