(data stored in SCRATCH zone)

EMBL: CP002505.PE318

CP002505.PE318       Location/Qualifiers
FT   CDS             360359..360733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0321"
FT                   /product="ribosomal protein S12"
FT                   /note="KEGG: dze:Dd1591_0316 30S ribosomal protein S12;
FT                   TIGRFAM: ribosomal protein S12; PFAM: ribosomal protein
FT                   S12/S23"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71951"
FT                   /db_xref="GOA:A0A0H3FA83"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FA83"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ADW71951.1"
FT                   /translation="MATINQLVRKPRSTKVAKSNVPALEACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDC
FT                   SGVKDRKQSRSKYGVKKPKS"
     MATINQLVRK PRSTKVAKSN VPALEACPQK RGVCTRVYTT TPKKPNSALR KVCRVRLTNG        60
     FEVTSYIGGE GHNLQEHSVI LIRGGRVKDL PGVRYHTVRG ALDCSGVKDR KQSRSKYGVK       120
     KPKS                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page