(data stored in SCRATCH zone)

EMBL: CP002505.PE34

CP002505.PE34        Location/Qualifiers
FT   CDS             37635..38783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0034"
FT                   /product="Mannitol dehydrogenase domain protein"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: spe:Spro_0073
FT                   mannitol-1-phosphate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71667"
FT                   /db_xref="GOA:A0A0H3F4K2"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4K2"
FT                   /inference="protein motif:PFAM:PF08125"
FT                   /protein_id="ADW71667.1"
FT                   /translation="MKALHFGAGNIGRGFIGKLLADAGIELTFADVSPALLDALNSRKG
FT                   YDVHVVGEQATVEPVSNVNAVNSAGQEAINLIAEVDLVTTAVGPTVLEKIAPNVAKGLV
FT                   LRHQQGNEKPLNIIACENMVRGTSQFKQHVFNALPEDEKAWVEAHVGFVDSAVDRIVPP
FT                   AAAGTTDPLEVTVETFSEWIVDKTQFKGELPEIAGMELTDNLMAFVERKLFTLNTGHAI
FT                   TAYLGQQAGHATIRDAILDEKVRLVVRGAMEESGEVLIRRYGFDPEKHFAYIEKILTRF
FT                   ENPYLHDDVERVGRQPLRKLSAGDRLIKPLLGTQEYRLPNDNLVRGIAAAMHYRSEQDP
FT                   QAKELVELLEKVGPKAALAQISGLPEDGEVVAKAVALYESMH"
     MKALHFGAGN IGRGFIGKLL ADAGIELTFA DVSPALLDAL NSRKGYDVHV VGEQATVEPV        60
     SNVNAVNSAG QEAINLIAEV DLVTTAVGPT VLEKIAPNVA KGLVLRHQQG NEKPLNIIAC       120
     ENMVRGTSQF KQHVFNALPE DEKAWVEAHV GFVDSAVDRI VPPAAAGTTD PLEVTVETFS       180
     EWIVDKTQFK GELPEIAGME LTDNLMAFVE RKLFTLNTGH AITAYLGQQA GHATIRDAIL       240
     DEKVRLVVRG AMEESGEVLI RRYGFDPEKH FAYIEKILTR FENPYLHDDV ERVGRQPLRK       300
     LSAGDRLIKP LLGTQEYRLP NDNLVRGIAA AMHYRSEQDP QAKELVELLE KVGPKAALAQ       360
     ISGLPEDGEV VAKAVALYES MH                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page