(data stored in SCRATCH zone)

EMBL: CP002505.PE344

CP002505.PE344       Location/Qualifiers
FT   CDS             382255..382587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0347"
FT                   /product="ribosomal protein L22"
FT                   /note="KEGG: spe:Spro_4539 50S ribosomal protein L22;
FT                   TIGRFAM: ribosomal protein L22; PFAM: ribosomal protein
FT                   L22/L17"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71977"
FT                   /db_xref="GOA:A0A0H3F5B4"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5B4"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ADW71977.1"
FT                   /translation="METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLAYTNKKAAG
FT                   LVKKVLESAIANAEHNDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHIT
FT                   VVVSDR"
     METIAKHRHA RSSAQKVRLV ADLIRGKKVS QALETLAYTN KKAAGLVKKV LESAIANAEH        60
     NDGADIDDLK VTKIFVDEGP SMKRIMPRAK GRADRILKRT SHITVVVSDR                  110
//

If you have problems or comments...

PBIL Back to PBIL home page