(data stored in SCRATCH zone)

EMBL: CP002505.PE358

CP002505.PE358       Location/Qualifiers
FT   CDS             387953..388387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0361"
FT                   /product="ribosomal protein L15"
FT                   /note="TIGRFAM: ribosomal protein L15; KEGG: ypb:YPTS_3871
FT                   50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71991"
FT                   /db_xref="GOA:A0A0H3FAD8"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAD8"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ADW71991.1"
FT                   /translation="MRLNTLSPADGAKQAPRRVGRGIGSGLGKTGGRGHKGQNSRSGGG
FT                   VRRGFEGGQMPLYRRLPKFGFTSRKAMITAEVRLSELALVEGDVIDLNALKAANVVGIQ
FT                   IEFAKVILSGEVGRAVTLRGLRVTKGARVAIEAAGGKIEE"
     MRLNTLSPAD GAKQAPRRVG RGIGSGLGKT GGRGHKGQNS RSGGGVRRGF EGGQMPLYRR        60
     LPKFGFTSRK AMITAEVRLS ELALVEGDVI DLNALKAANV VGIQIEFAKV ILSGEVGRAV       120
     TLRGLRVTKG ARVAIEAAGG KIEE                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page