(data stored in SCRATCH zone)

EMBL: CP002505.PE366

CP002505.PE366       Location/Qualifiers
FT   CDS             393057..393425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0369"
FT                   /product="DnaJ family protein"
FT                   /note="PFAM: DnaJ homologue, subfamily C, member 28,
FT                   conserved domain; KEGG: kpu:KP1_5012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71999"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7R1"
FT                   /inference="protein motif:PFAM:PF09350"
FT                   /protein_id="ADW71999.1"
FT                   /translation="MFLIDQWVEKHIKDAQEKGEFDNLPGNGRPVIIDDESAVPEELRT
FT                   SYRILKNAGYLPPELQDRKEAIDLDHLLNILDSDDPKFLPAEKRLKVLQMRLQQAGMNT
FT                   DFLRGHYKNALKDKLRGK"
     MFLIDQWVEK HIKDAQEKGE FDNLPGNGRP VIIDDESAVP EELRTSYRIL KNAGYLPPEL        60
     QDRKEAIDLD HLLNILDSDD PKFLPAEKRL KVLQMRLQQA GMNTDFLRGH YKNALKDKLR       120
     GK                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page