(data stored in SCRATCH zone)

EMBL: CP002505.PE382

CP002505.PE382       Location/Qualifiers
FT   CDS             complement(411507..413468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0385"
FT                   /product="acetate/CoA ligase"
FT                   /note="KEGG: spe:Spro_0297 acetyl-CoA synthetase; TIGRFAM:
FT                   acetate/CoA ligase; PFAM: AMP-dependent synthetase and
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72015"
FT                   /db_xref="GOA:A0A0H3F4A5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4A5"
FT                   /inference="protein motif:TFAM:TIGR02188"
FT                   /protein_id="ADW72015.1"
FT                   /translation="MSHVYKHPIPASIAERTLITPEKYQQYYQKSVEDPDAFWGEQAKV
FT                   LDWIKPFTKVKNTSFAPGNIDIRWFEDGTLNLAANCLDRHLSDKGDQTALIWEGDDPKA
FT                   ENKHVTYKQLHHDVCQFANVLKGLGVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVI
FT                   FAGFSPEAVAGRIIDSNARLVITADEGLRAGRTIPLKQNVDDALKNPSVTSITHSIIFK
FT                   RTGKQGEWKEGRDIWWHDAIEGISADCPPEEMKAEDPLFILYTSGSTGKPKGVLHTTGG
FT                   YLVYAALTFKYTFDYHDGDIYWCTADVGWVTGHSYLLYGPLACGAISLMFEGVPNYPTP
FT                   ARMAQVIDKHKVNILYTAPTAIRALMAEGDKAIEGTSRASLRIMGSVGEPINPEAWEWY
FT                   YRTIGNSQCPIVDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNEGVPQE
FT                   GACEGNLVITDSWPGQARTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRV
FT                   DDVLNISGHRLGTAEIESALVSHPKIAEAAVVGIPHNIKGQAIYAYITLNHGEEPSPEL
FT                   YTEVRNWVRKEIGSIATPDILHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLAD
FT                   PGVVDKLLEEKQSMKVPS"
     MSHVYKHPIP ASIAERTLIT PEKYQQYYQK SVEDPDAFWG EQAKVLDWIK PFTKVKNTSF        60
     APGNIDIRWF EDGTLNLAAN CLDRHLSDKG DQTALIWEGD DPKAENKHVT YKQLHHDVCQ       120
     FANVLKGLGV KKGDVVAIYM PMVPEAAVAM LACARIGAVH SVIFAGFSPE AVAGRIIDSN       180
     ARLVITADEG LRAGRTIPLK QNVDDALKNP SVTSITHSII FKRTGKQGEW KEGRDIWWHD       240
     AIEGISADCP PEEMKAEDPL FILYTSGSTG KPKGVLHTTG GYLVYAALTF KYTFDYHDGD       300
     IYWCTADVGW VTGHSYLLYG PLACGAISLM FEGVPNYPTP ARMAQVIDKH KVNILYTAPT       360
     AIRALMAEGD KAIEGTSRAS LRIMGSVGEP INPEAWEWYY RTIGNSQCPI VDTWWQTETG       420
     GFMITPLPGA TELKAGSATR PFFGVQPALV DNEGVPQEGA CEGNLVITDS WPGQARTLFG       480
     DHERFEQTYF STFKNMYFSG DGARRDEDGY YWITGRVDDV LNISGHRLGT AEIESALVSH       540
     PKIAEAAVVG IPHNIKGQAI YAYITLNHGE EPSPELYTEV RNWVRKEIGS IATPDILHWT       600
     DSLPKTRSGK IMRRILRKIA AGDTSNLGDT STLADPGVVD KLLEEKQSMK VPS              653
//

If you have problems or comments...

PBIL Back to PBIL home page