(data stored in SCRATCH zone)

EMBL: CP002505.PE386

CP002505.PE386       Location/Qualifiers
FT   CDS             417959..418930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0389"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_4104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72019"
FT                   /db_xref="GOA:A0A0H3F7T1"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F7T1"
FT                   /inference="similar to AA sequence:KEGG:YpsIP31758_4104"
FT                   /protein_id="ADW72019.1"
FT                   /translation="MAGIDRFQAGRMVFLLLLLFFSRSALALDCVEKGTGIVDKPAIPV
FT                   GQLAIPANVPAGTKVWESNDINVTAYCDNVLGSIIDVVHFYFNPKSQSIGEGLLLGVSY
FT                   NGQDLEQNEQRLSTNSTPIKKGQNVTVNVTFRLYIKVSGNAPSSGHYQGADQFTVFQLD
FT                   GSRGINKTPGAKNLKYNLSGLQGIRFLACGSDLKVYPESQIVDFGAIQSTTLSRSSGVS
FT                   LPFAIKAVKQGCLDNFSLQAEFSTASPLLDNTAIDLSNGAKLMLYNDQDKAITFNRYDD
FT                   FAELNNVNEVTKNFTAKLSAIPGKTLSLGQFDASVIVKINYY"
     MAGIDRFQAG RMVFLLLLLF FSRSALALDC VEKGTGIVDK PAIPVGQLAI PANVPAGTKV        60
     WESNDINVTA YCDNVLGSII DVVHFYFNPK SQSIGEGLLL GVSYNGQDLE QNEQRLSTNS       120
     TPIKKGQNVT VNVTFRLYIK VSGNAPSSGH YQGADQFTVF QLDGSRGINK TPGAKNLKYN       180
     LSGLQGIRFL ACGSDLKVYP ESQIVDFGAI QSTTLSRSSG VSLPFAIKAV KQGCLDNFSL       240
     QAEFSTASPL LDNTAIDLSN GAKLMLYNDQ DKAITFNRYD DFAELNNVNE VTKNFTAKLS       300
     AIPGKTLSLG QFDASVIVKI NYY                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page