(data stored in SCRATCH zone)

EMBL: CP002505.PE42

CP002505.PE42        Location/Qualifiers
FT   CDS             complement(45441..46061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0042"
FT                   /product="Manganese/iron superoxide dismutase-like protein"
FT                   /note="PFAM: Manganese/iron superoxide dismutase-like;
FT                   KEGG: dda:Dd703_0072 superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71675"
FT                   /db_xref="GOA:A0A0H3F3H9"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3H9"
FT                   /inference="protein motif:PFAM:PF00081"
FT                   /protein_id="ADW71675.1"
FT                   /translation="MSYSLPSLPYAYDALEPHFDKETMEIHHTKHHQAYVNNANAALES
FT                   LPELAALPVEELITKLDQVPADKKVALRNNAGGHANHSLFWKGLKTGTTLQGELKSAIE
FT                   RDFGSVDAFKETFEKAATTRFGSGWAWLVLKDGKLAVVSTANQDSPLMGEAISGASGYP
FT                   LLGLDVWEHAYYLKYQNKRPDYIKAFWAVVNWDEAAKRLAEAK"
     MSYSLPSLPY AYDALEPHFD KETMEIHHTK HHQAYVNNAN AALESLPELA ALPVEELITK        60
     LDQVPADKKV ALRNNAGGHA NHSLFWKGLK TGTTLQGELK SAIERDFGSV DAFKETFEKA       120
     ATTRFGSGWA WLVLKDGKLA VVSTANQDSP LMGEAISGAS GYPLLGLDVW EHAYYLKYQN       180
     KRPDYIKAFW AVVNWDEAAK RLAEAK                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page