(data stored in SCRATCH zone)

EMBL: CP002505.PE424

CP002505.PE424       Location/Qualifiers
FT   CDS             460298..461602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0428"
FT                   /product="GTP-binding proten HflX"
FT                   /note="KEGG: spe:Spro_0432 putative GTPase HflX; TIGRFAM:
FT                   GTP-binding proten HflX; small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72057"
FT                   /db_xref="GOA:A0A0H3F5H9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5H9"
FT                   /inference="protein motif:TFAM:TIGR03156"
FT                   /protein_id="ADW72057.1"
FT                   /translation="MFDRYEAGEQAVLVHIYFSQDKDTEDLSEFESLVSSAGVEALQVV
FT                   TGSRKAPHPKYFVGEGKAQEIADAVKATGASVILFDHALSPGQERNLEALCECRVVDRT
FT                   GLILDIFAQRARTHEGKLQVELAQLRHIATRLVRGWTHLERQGGGIGARGPGETQLETD
FT                   RRLLRDRITLILSRLEKVAKQREQGRRSRVRADIPTVSLVGYTNAGKSTLFNRITQADV
FT                   YVANQLFATLDPTLRRIIVADVGETVLADTVGFIRHLPHDLVAAFKATLQETRQASLLL
FT                   HVIDAADIRVQENIDAVNTVLAEIEADEIPALLVMNKIDMLDDFVPRIDRNEENLPVRV
FT                   WLSAVTGEGIPLLFQALTERLSGEIAQHELCLPPEAGRLRSRFYQLQAIEKEWIEEDGS
FT                   IGLMVRMPIVDWRRLCKQEQELESYVRNQSLSDLA"
     MFDRYEAGEQ AVLVHIYFSQ DKDTEDLSEF ESLVSSAGVE ALQVVTGSRK APHPKYFVGE        60
     GKAQEIADAV KATGASVILF DHALSPGQER NLEALCECRV VDRTGLILDI FAQRARTHEG       120
     KLQVELAQLR HIATRLVRGW THLERQGGGI GARGPGETQL ETDRRLLRDR ITLILSRLEK       180
     VAKQREQGRR SRVRADIPTV SLVGYTNAGK STLFNRITQA DVYVANQLFA TLDPTLRRII       240
     VADVGETVLA DTVGFIRHLP HDLVAAFKAT LQETRQASLL LHVIDAADIR VQENIDAVNT       300
     VLAEIEADEI PALLVMNKID MLDDFVPRID RNEENLPVRV WLSAVTGEGI PLLFQALTER       360
     LSGEIAQHEL CLPPEAGRLR SRFYQLQAIE KEWIEEDGSI GLMVRMPIVD WRRLCKQEQE       420
     LESYVRNQSL SDLA                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page