(data stored in SCRATCH zone)

EMBL: CP002505.PE465

CP002505.PE465       Location/Qualifiers
FT   CDS             502696..503007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0469"
FT                   /product="ribosomal protein L21"
FT                   /note="KEGG: yen:YE0418 50S ribosomal protein L21; TIGRFAM:
FT                   ribosomal protein L21; PFAM: ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72098"
FT                   /db_xref="GOA:A0A0H3F5B0"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5B0"
FT                   /inference="protein motif:TFAM:TIGR00061"
FT                   /protein_id="ADW72098.1"
FT                   /translation="MYAVFQSGGKQHRVSEGQTIRLEKLDVATGEAIEFDQVLMIANGE
FT                   EINIGLPLVAGGVIKAEVVAHGRGEKVKIVKFRRRKHYRKQQGHRQWFTDVKITGISA"
     MYAVFQSGGK QHRVSEGQTI RLEKLDVATG EAIEFDQVLM IANGEEINIG LPLVAGGVIK        60
     AEVVAHGRGE KVKIVKFRRR KHYRKQQGHR QWFTDVKITG ISA                         103
//

If you have problems or comments...

PBIL Back to PBIL home page