(data stored in SCRATCH zone)

EMBL: CP002505.PE468

CP002505.PE468       Location/Qualifiers
FT   CDS             504359..505531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0472"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="KEGG: spe:Spro_0476 GTPase ObgE; TIGRFAM:
FT                   GTP-binding protein Obg/CgtA; small GTP-binding protein;
FT                   PFAM: GTP1/OBG sub domain protein; GTP-binding protein
FT                   HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72101"
FT                   /db_xref="GOA:A0A0H3FAN5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAN5"
FT                   /inference="protein motif:TFAM:TIGR02729"
FT                   /protein_id="ADW72101.1"
FT                   /translation="MKFVDEATILVVAGDGGNGCVSFRREKYIPRGGPDGGDGGDGGDV
FT                   YLVADENLNTLIDFRFVKSYRAERGTNGQSSDCTGKRGKDITIKVPVGTRVLDQSTGEV
FT                   LADMTKNGQVNMVAKGGFHGLGNTRFKSSVNRSPRQKTMGTKGEERDIALELMLLADVG
FT                   MLGLPNAGKSTFIRSVSAAKPKVADYPFTTLVPSLGVVRMDHEQSFVVADIPGLIEGAS
FT                   EGAGLGIRFLKHLERCRVLLHLIDIAPIDESDPIENAKVIINELKQYNAKLAEKPRWLV
FT                   FNKVDLIEKEEAETRAKAIADALGWEGNYYLISAANREGVNALCWDVMKFINENPKHMA
FT                   IEEAAPEKVEFMWDDYHREQLAEVESEADDDWDDDWDEDDDEGVEIIYER"
     MKFVDEATIL VVAGDGGNGC VSFRREKYIP RGGPDGGDGG DGGDVYLVAD ENLNTLIDFR        60
     FVKSYRAERG TNGQSSDCTG KRGKDITIKV PVGTRVLDQS TGEVLADMTK NGQVNMVAKG       120
     GFHGLGNTRF KSSVNRSPRQ KTMGTKGEER DIALELMLLA DVGMLGLPNA GKSTFIRSVS       180
     AAKPKVADYP FTTLVPSLGV VRMDHEQSFV VADIPGLIEG ASEGAGLGIR FLKHLERCRV       240
     LLHLIDIAPI DESDPIENAK VIINELKQYN AKLAEKPRWL VFNKVDLIEK EEAETRAKAI       300
     ADALGWEGNY YLISAANREG VNALCWDVMK FINENPKHMA IEEAAPEKVE FMWDDYHREQ       360
     LAEVESEADD DWDDDWDEDD DEGVEIIYER                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page