(data stored in SCRATCH zone)

EMBL: CP002505.PE474

CP002505.PE474       Location/Qualifiers
FT   CDS             complement(511184..511480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0478"
FT                   /product="protein of unknown function UPF0044"
FT                   /note="PFAM: protein of unknown function UPF0044; KEGG:
FT                   spe:Spro_0481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72107"
FT                   /db_xref="GOA:A0A0H3F5L9"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5L9"
FT                   /inference="protein motif:PFAM:PF01985"
FT                   /protein_id="ADW72107.1"
FT                   /translation="MNLNNKQKQYLKGLAHPLKPVVMLGNNGLTEGVLAEIEQALQHHE
FT                   LIKVKVAAEERETKSLIVDAIVRETKACNVQVIGNMLVLYRPSTEDRKIILPR"
     MNLNNKQKQY LKGLAHPLKP VVMLGNNGLT EGVLAEIEQA LQHHELIKVK VAAEERETKS        60
     LIVDAIVRET KACNVQVIGN MLVLYRPSTE DRKIILPR                                98
//

If you have problems or comments...

PBIL Back to PBIL home page