(data stored in SCRATCH zone)

EMBL: CP002505.PE478

CP002505.PE478       Location/Qualifiers
FT   CDS             515259..516599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0482"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="KEGG: pwa:Pecwa_0803 phosphoglucosamine mutase;
FT                   TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72111"
FT                   /db_xref="GOA:A0A0H3FAP5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAP5"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ADW72111.1"
FT                   /translation="MSNRKYFGTDGIRGKVGDTPITPDFVLKLGWAAGKVLARHGSRKV
FT                   IIGKDTRISGYMLESALEAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHN
FT                   PYYDNGIKFFTIDGTKLPDEVEEAIEAELEKPLTCVESAELGKASRIVDAAGRYIEFCK
FT                   GTFPTELSLNSLKIVVDCANGATYHIAPSVLRELGAKVIAIGCEPDGMNINEECGATDV
FT                   RQLQQRVLAEKADVGLAFDGDGDRLIMVDHEGNKVDGDQILYIIAREGLRQGQLKGGAV
FT                   GTLMSNMGLELALKQLGIPFTRAKVGDRYVLEKMQEKGWRIGAENSGHIILLDKTTTGD
FT                   GIVAGLQVLTAMVRNHMSLHDLCSGMKLLPQVLINVRFAGEHDPLESDEVKQVTAEVEK
FT                   QLAGRGRVLLRKSGTEPLLRVMVEGEDAELVEKLANRIADAVKAVKA"
     MSNRKYFGTD GIRGKVGDTP ITPDFVLKLG WAAGKVLARH GSRKVIIGKD TRISGYMLES        60
     ALEAGLAAAG LSASFTGPMP TPAVAYLTRT FRAEAGIVIS ASHNPYYDNG IKFFTIDGTK       120
     LPDEVEEAIE AELEKPLTCV ESAELGKASR IVDAAGRYIE FCKGTFPTEL SLNSLKIVVD       180
     CANGATYHIA PSVLRELGAK VIAIGCEPDG MNINEECGAT DVRQLQQRVL AEKADVGLAF       240
     DGDGDRLIMV DHEGNKVDGD QILYIIAREG LRQGQLKGGA VGTLMSNMGL ELALKQLGIP       300
     FTRAKVGDRY VLEKMQEKGW RIGAENSGHI ILLDKTTTGD GIVAGLQVLT AMVRNHMSLH       360
     DLCSGMKLLP QVLINVRFAG EHDPLESDEV KQVTAEVEKQ LAGRGRVLLR KSGTEPLLRV       420
     MVEGEDAELV EKLANRIADA VKAVKA                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page