(data stored in SCRATCH zone)

EMBL: CP002505.PE481

CP002505.PE481       Location/Qualifiers
FT   CDS             519703..522396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0486"
FT                   /product="translation initiation factor IF-2"
FT                   /note="KEGG: ypb:YPTS_0510 translation initiation factor
FT                   IF-2; TIGRFAM: translation initiation factor IF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; Initiation factor 2 associated domain protein
FT                   ; translation initiation factor IF-2 domain-containing
FT                   protein; elongation factor Tu domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72114"
FT                   /db_xref="GOA:A0A0H3F831"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F831"
FT                   /inference="protein motif:TFAM:TIGR00487"
FT                   /protein_id="ADW72114.1"
FT                   /translation="MTDVTVKSLAAEIQTPVDRLVQQFADAGISKSEADSVTQQEKETL
FT                   LSHLNGGNSGASNKLTLQRKTRSTLNIPSTGGKSKSVQIEVRKKRTYVKRDMTEAELAQ
FT                   AEAEEQAKRDAEEQAQRAAAEQAQREAQEKAKRAAEEQAKREAADKAKRDAAEKDKVTN
FT                   QNTDEVTKPAQAEKARREAEAAELKRKTEEEAQRKIEENAKRIAEEARKMADSGVWTEA
FT                   TAPSESESADYHVTTSTHARAAEDENDAKVEGERRSRTRGGKATKQKKGNKLSESKADR
FT                   EEARAVGRNGKGKRKPSTLQQSFNKPVVAVNRDVVVGETITVAELANKMAVKGSQVIKT
FT                   MMKLGAMATINQVIDQETAQLVAEEMGHKVILRRENELEEALMSDRDTGASAAAEPRAP
FT                   VVTIMGHVDHGKTSLLDYIRSTKVAAGEAGGITQHIGAYHVETENGMITFLDTPGHAAF
FT                   TSMRARGAQATDIVVLVVSADDGVMPQTIEAVQHAKAAGVPIVVAVNKIDKPDADPDRV
FT                   RTELSQYGVMPEEWGGESQFIHVSAKVGTGIDDLLQAILLQAEVLELKAVRTGMASGVV
FT                   IESFLDKGRGPVATVLVQEGTLNKGDIILCGFEYGRVRAMRDEMGRDITSAGPSIPVEV
FT                   LGLSSVPAAGDEVTVVRDEKKAREVALYRQGKFREVKLARQQKSKLENMFANMTEGEVS
FT                   ELNIVLKSDVQGSCEAISDALQSLSTDEVKVKIVGMGVGGITETDATLAAASNAIILGF
FT                   NVRADASARRVVESESLDLRYYSVIYNLIDEVKQAMSGMLAPEYKQQIIGLAEVRDVFK
FT                   SPKFGAIAGCMVTEGMIKRNNPIRVLRENVVIYEGELESLRRFKDDVAEVRNGMECGIG
FT                   VKNYNDVRTGDVIEVFEIIEIKRTIA"
     MTDVTVKSLA AEIQTPVDRL VQQFADAGIS KSEADSVTQQ EKETLLSHLN GGNSGASNKL        60
     TLQRKTRSTL NIPSTGGKSK SVQIEVRKKR TYVKRDMTEA ELAQAEAEEQ AKRDAEEQAQ       120
     RAAAEQAQRE AQEKAKRAAE EQAKREAADK AKRDAAEKDK VTNQNTDEVT KPAQAEKARR       180
     EAEAAELKRK TEEEAQRKIE ENAKRIAEEA RKMADSGVWT EATAPSESES ADYHVTTSTH       240
     ARAAEDENDA KVEGERRSRT RGGKATKQKK GNKLSESKAD REEARAVGRN GKGKRKPSTL       300
     QQSFNKPVVA VNRDVVVGET ITVAELANKM AVKGSQVIKT MMKLGAMATI NQVIDQETAQ       360
     LVAEEMGHKV ILRRENELEE ALMSDRDTGA SAAAEPRAPV VTIMGHVDHG KTSLLDYIRS       420
     TKVAAGEAGG ITQHIGAYHV ETENGMITFL DTPGHAAFTS MRARGAQATD IVVLVVSADD       480
     GVMPQTIEAV QHAKAAGVPI VVAVNKIDKP DADPDRVRTE LSQYGVMPEE WGGESQFIHV       540
     SAKVGTGIDD LLQAILLQAE VLELKAVRTG MASGVVIESF LDKGRGPVAT VLVQEGTLNK       600
     GDIILCGFEY GRVRAMRDEM GRDITSAGPS IPVEVLGLSS VPAAGDEVTV VRDEKKAREV       660
     ALYRQGKFRE VKLARQQKSK LENMFANMTE GEVSELNIVL KSDVQGSCEA ISDALQSLST       720
     DEVKVKIVGM GVGGITETDA TLAAASNAII LGFNVRADAS ARRVVESESL DLRYYSVIYN       780
     LIDEVKQAMS GMLAPEYKQQ IIGLAEVRDV FKSPKFGAIA GCMVTEGMIK RNNPIRVLRE       840
     NVVIYEGELE SLRRFKDDVA EVRNGMECGI GVKNYNDVRT GDVIEVFEII EIKRTIA          897
//

If you have problems or comments...

PBIL Back to PBIL home page