(data stored in SCRATCH zone)

EMBL: CP002505.PE49

CP002505.PE49        Location/Qualifiers
FT   CDS             53612..55150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0049"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: ect:ECIAI39_4105
FT                   aldehyde dehydrogenase B"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71682"
FT                   /db_xref="GOA:A0A0H3F4L3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4L3"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADW71682.1"
FT                   /translation="MAYDKNPHAVKPEEYGFPLKLKKQYDNFIGGEWVAPVKKEYYDNL
FT                   TPVTGEVLCKVASSSTDDVDLALDAAHQAKDAWGKMPVQQRANLLLKVADRMEQNLELL
FT                   ANAETWDNGKPIRETSGADVPLAIDHFRYFASCVRAQEGGISEIDSETVAYHFHEPLGV
FT                   VAQIIPWNFPLLMACWKMAPALAAGNCIVLKPAKLTPLSVLLLMELVQDILPAGVINVV
FT                   NGAGGEIGEYLATSKRIAKVAFTGSTEVGQRIAGYAAQNLIPATLELGGKSPNIFFADV
FT                   MDKEDEFFDKALEGFALFAFNQGEVCTCPSRALVQESIYERFMERAIKRVEAIKTGNPL
FT                   DMETQMGAQVSAGQMKTILDYIEIGKNEGAEVLTGGAKKKLEGSLNEGYYLQPTILLGK
FT                   NNMRVFQEEIFGPVLAVTTFKDMDEALQIANDTAYGLGAGVWSRDGNVAYHMGRNIQAG
FT                   RVWTNCYHAYPAHAAFGGYKQSGIGRETHKMMLDHYQQTKCLLVSYSSKPMGLF"
     MAYDKNPHAV KPEEYGFPLK LKKQYDNFIG GEWVAPVKKE YYDNLTPVTG EVLCKVASSS        60
     TDDVDLALDA AHQAKDAWGK MPVQQRANLL LKVADRMEQN LELLANAETW DNGKPIRETS       120
     GADVPLAIDH FRYFASCVRA QEGGISEIDS ETVAYHFHEP LGVVAQIIPW NFPLLMACWK       180
     MAPALAAGNC IVLKPAKLTP LSVLLLMELV QDILPAGVIN VVNGAGGEIG EYLATSKRIA       240
     KVAFTGSTEV GQRIAGYAAQ NLIPATLELG GKSPNIFFAD VMDKEDEFFD KALEGFALFA       300
     FNQGEVCTCP SRALVQESIY ERFMERAIKR VEAIKTGNPL DMETQMGAQV SAGQMKTILD       360
     YIEIGKNEGA EVLTGGAKKK LEGSLNEGYY LQPTILLGKN NMRVFQEEIF GPVLAVTTFK       420
     DMDEALQIAN DTAYGLGAGV WSRDGNVAYH MGRNIQAGRV WTNCYHAYPA HAAFGGYKQS       480
     GIGRETHKMM LDHYQQTKCL LVSYSSKPMG LF                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page