(data stored in SCRATCH zone)

EMBL: CP002505.PE494

CP002505.PE494       Location/Qualifiers
FT   CDS             536789..537310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0499"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   spe:Spro_0505 sterol-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72127"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR016830"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5P0"
FT                   /inference="protein motif:PFAM:PF02036"
FT                   /protein_id="ADW72127.1"
FT                   /translation="MLQKLRARLVRQGPSLLSVPLKFTPFALQRQVVQQVLSWQLRQAL
FT                   ADGELDFLEGRWLKIDVSDLNLSWLMSVDEGKLVIAEHGEADVSFSGSANDLILIAARK
FT                   EDPDTLFFQRRLRIEGDTELGLYVKNLMDSIDLDTMPLLLKNGLLRLADFVEAGLQEDR
FT                   GSKTPVAEPC"
     MLQKLRARLV RQGPSLLSVP LKFTPFALQR QVVQQVLSWQ LRQALADGEL DFLEGRWLKI        60
     DVSDLNLSWL MSVDEGKLVI AEHGEADVSF SGSANDLILI AARKEDPDTL FFQRRLRIEG       120
     DTELGLYVKN LMDSIDLDTM PLLLKNGLLR LADFVEAGLQ EDRGSKTPVA EPC              173
//

If you have problems or comments...

PBIL Back to PBIL home page