(data stored in SCRATCH zone)

EMBL: CP002505.PE495

CP002505.PE495       Location/Qualifiers
FT   CDS             537304..537807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0500"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   yen:YE0452 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72128"
FT                   /db_xref="GOA:A0A0H3F5E0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5E0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADW72128.1"
FT                   /translation="MLIRTEIPVDAAGIDRLLRASFPTGAEADLVQELREDGLLTLGVV
FT                   ATDDEGGVVGYVAFCPVDIQGEDRNWVALAPLVVEQSLRGQGLGEKLVYEGLDSLNEFG
FT                   YAAVVVLGDPAYYNRFGFKPAAVHGLHCRWIGTEAAFQLFTLSDDALSDASGEVVFPSA
FT                   FNRF"
     MLIRTEIPVD AAGIDRLLRA SFPTGAEADL VQELREDGLL TLGVVATDDE GGVVGYVAFC        60
     PVDIQGEDRN WVALAPLVVE QSLRGQGLGE KLVYEGLDSL NEFGYAAVVV LGDPAYYNRF       120
     GFKPAAVHGL HCRWIGTEAA FQLFTLSDDA LSDASGEVVF PSAFNRF                     167
//

If you have problems or comments...

PBIL Back to PBIL home page