(data stored in SCRATCH zone)

EMBL: CP002505.PE50

CP002505.PE50        Location/Qualifiers
FT   CDS             complement(55280..56518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0050"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="KEGG: spe:Spro_0092 major facilitator transporter;
FT                   manually curated; PFAM: major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71683"
FT                   /db_xref="GOA:A0A0H3F4B0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4B0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADW71683.1"
FT                   /translation="MHNSPNTASLLGRQALLFPLCLVLFEFATYIGNDMIQPGMLAVVA
FT                   NFNAGEEWVPTSMTAYLAGGMFLQWLLGPLSDRRGRRPVMLAGVSFFIITCLAILFVQN
FT                   IEQFMVMRFLQGISLCFIGAVGYAAIQESFEESVCIKITAMMANVALIAPLLGPLAGAA
FT                   LIHIAPWQSMFVIFAVLAAIALWGLWKSMPETASRLGEPFSMPSLLRDYKHVLKNRQFV
FT                   CGALAIGFASLPLLTWIAQSPVILISGEGLAAYDYGLLQVPIFGALIIGNVTLARLTGK
FT                   RTVEYLIKLGAGPMVVGLLIAAVATMFSAHAYLWMTAGLSLYAFGIGVANAGLYRLTLF
FT                   SSDMSKGTVSAAMGVISMMIFTVGIELAKVAYVEGGAGMFNMFNLISGLAWLALVVVFL
FT                   RSRQVVLPPNSVV"
     MHNSPNTASL LGRQALLFPL CLVLFEFATY IGNDMIQPGM LAVVANFNAG EEWVPTSMTA        60
     YLAGGMFLQW LLGPLSDRRG RRPVMLAGVS FFIITCLAIL FVQNIEQFMV MRFLQGISLC       120
     FIGAVGYAAI QESFEESVCI KITAMMANVA LIAPLLGPLA GAALIHIAPW QSMFVIFAVL       180
     AAIALWGLWK SMPETASRLG EPFSMPSLLR DYKHVLKNRQ FVCGALAIGF ASLPLLTWIA       240
     QSPVILISGE GLAAYDYGLL QVPIFGALII GNVTLARLTG KRTVEYLIKL GAGPMVVGLL       300
     IAAVATMFSA HAYLWMTAGL SLYAFGIGVA NAGLYRLTLF SSDMSKGTVS AAMGVISMMI       360
     FTVGIELAKV AYVEGGAGMF NMFNLISGLA WLALVVVFLR SRQVVLPPNS VV               412
//

If you have problems or comments...

PBIL Back to PBIL home page