(data stored in SCRATCH zone)

EMBL: CP002505.PE505

CP002505.PE505       Location/Qualifiers
FT   CDS             complement(544369..545451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0510"
FT                   /product="phosphonate metabolism"
FT                   /note="PFAM: phosphonate metabolism; KEGG: spe:Spro_0519
FT                   phosphonate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72138"
FT                   /db_xref="GOA:A0A0H3F5F1"
FT                   /db_xref="InterPro:IPR008773"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5F1"
FT                   /inference="protein motif:PFAM:PF05861"
FT                   /protein_id="ADW72138.1"
FT                   /translation="MYVAVKGGEKAIAAAHQLLAHERRGNTGVNELGCDQIEQQLGLAV
FT                   DRVMSEGGIYDRELAALAIKQSGGDLVEAIFLLRAYRTTLPRLATSEPLNTKSMRLERR
FT                   ISAIYKDLPGGQVLGPTYDYTHRLLDFALLAEGEAPFTPIADEPQPEECGHVFDLLTNQ
FT                   QLAVREEDDGTEPEDITRTPPVFPASRAARLQQLVRGDEGFLLSLSYSTQRGYGRNHPF
FT                   AGEIRTGWLTVEIVPEELGFAVDIGEILLTECEMVNGFVAPEDKPPHFTRGYGLVFGRA
FT                   ERKAMSMSLVDRALQTREYNEQISSPAQDEEFVLSHADNVEAAGFVSHLKLPHYVDFQA
FT                   ELELLKRLRATKEQDSANEQ"
     MYVAVKGGEK AIAAAHQLLA HERRGNTGVN ELGCDQIEQQ LGLAVDRVMS EGGIYDRELA        60
     ALAIKQSGGD LVEAIFLLRA YRTTLPRLAT SEPLNTKSMR LERRISAIYK DLPGGQVLGP       120
     TYDYTHRLLD FALLAEGEAP FTPIADEPQP EECGHVFDLL TNQQLAVREE DDGTEPEDIT       180
     RTPPVFPASR AARLQQLVRG DEGFLLSLSY STQRGYGRNH PFAGEIRTGW LTVEIVPEEL       240
     GFAVDIGEIL LTECEMVNGF VAPEDKPPHF TRGYGLVFGR AERKAMSMSL VDRALQTREY       300
     NEQISSPAQD EEFVLSHADN VEAAGFVSHL KLPHYVDFQA ELELLKRLRA TKEQDSANEQ       360
//

If you have problems or comments...

PBIL Back to PBIL home page