(data stored in SCRATCH zone)

EMBL: CP002505.PE507

CP002505.PE507       Location/Qualifiers
FT   CDS             complement(546036..546479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0512"
FT                   /product="phosphonate C-P lyase system protein PhnG"
FT                   /note="KEGG: spe:Spro_0521 phosphonate metabolism PhnG;
FT                   TIGRFAM: phosphonate C-P lyase system protein PhnG; PFAM:
FT                   phosphonate metabolism PhnG"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72140"
FT                   /db_xref="GOA:A0A0H3F4K8"
FT                   /db_xref="InterPro:IPR009609"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4K8"
FT                   /inference="protein motif:TFAM:TIGR03293"
FT                   /protein_id="ADW72140.1"
FT                   /translation="MDHLQTRQRWMSVLAHSRPDELLAHWQPLNLSPQFERIRAAETGL
FT                   TQLQGRMGGTGKRFVMGDMTVTRAVIQLDGGVYGYSYVSGRNKPHAELCAVIDGLLQMQ
FT                   GMDELLHKRVIAPLAALQQERRQQRAREVASSRVDFFTLVRGE"
     MDHLQTRQRW MSVLAHSRPD ELLAHWQPLN LSPQFERIRA AETGLTQLQG RMGGTGKRFV        60
     MGDMTVTRAV IQLDGGVYGY SYVSGRNKPH AELCAVIDGL LQMQGMDELL HKRVIAPLAA       120
     LQQERRQQRA REVASSRVDF FTLVRGE                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page