(data stored in SCRATCH zone)

EMBL: CP002505.PE513

CP002505.PE513       Location/Qualifiers
FT   CDS             complement(548911..551094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0518"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; KEGG: spe:Spro_0525 anaerobic ribonucleoside
FT                   triphosphate reductase; PFAM: formate C-acetyltransferase
FT                   glycine radical; ATP-cone domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72146"
FT                   /db_xref="GOA:A0A0H3FAS8"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAS8"
FT                   /inference="protein motif:TFAM:TIGR02487"
FT                   /protein_id="ADW72146.1"
FT                   /translation="MKADRQETVPAKSTKMQPIVIKRDGCQVPFDEVLIKQAVQRAAEA
FT                   AGIDSVDYCAQVARIVAENLQDQARVDIHEIQDAVENQLMAGPHKKLARAYIEYRHDRD
FT                   VKREMRGRLNQEIRGLVEQSNMALLNENANKDSKVIPTQRDLLAGIVAKHYAKQHILPR
FT                   DVVLAHERGEIHYHDLDYSPFFPMFNCMLIDLKGMLNHGFKMGNAEIDTPKSISTATAV
FT                   TAQIIAQVASHIYGGTTINRIDEVLAPFVTASFNKHRQTAEEWQIADAEAFARNRTEKE
FT                   CYDAFQSLEYEVNTLHTANGQTPFVTFGFGLGTSWESRLIQQSILRNRIAGLGKNRKTA
FT                   VFPKLVFAIRDGLNHKAGDANYDIKQLALECASKRMYPDILNYDQVVKVTGSFKTPMGC
FT                   RSFLGVYEENGEMIHEGRNNIGVISLNLPRIALEAKRDEAAFWTLLDERLLLAKKALMT
FT                   RIARLEGIKARVAPILYMEGACGVRLKADDDISGIFKNGRASISLGYIGVHETINALFG
FT                   DQTHVFDASQLREKAVAIVARLKAATDSWKDETGYGFSLYSTPSENLCDRFCRLDKAEF
FT                   GLVAGVTDKGYYTNSFHLDVEKKVNPYEKLDFEAPYPPLSNGGFICYGEYPNLQHNLKA
FT                   LEDVWDYSYTRVPYYGTNTPIDECYDCGYTGEFECTSKGFTCPKCGNHEPSRVSVTRRV
FT                   CGYLGSPDARPFNAGKQEEVKRRIKHLGNGQLG"
     MKADRQETVP AKSTKMQPIV IKRDGCQVPF DEVLIKQAVQ RAAEAAGIDS VDYCAQVARI        60
     VAENLQDQAR VDIHEIQDAV ENQLMAGPHK KLARAYIEYR HDRDVKREMR GRLNQEIRGL       120
     VEQSNMALLN ENANKDSKVI PTQRDLLAGI VAKHYAKQHI LPRDVVLAHE RGEIHYHDLD       180
     YSPFFPMFNC MLIDLKGMLN HGFKMGNAEI DTPKSISTAT AVTAQIIAQV ASHIYGGTTI       240
     NRIDEVLAPF VTASFNKHRQ TAEEWQIADA EAFARNRTEK ECYDAFQSLE YEVNTLHTAN       300
     GQTPFVTFGF GLGTSWESRL IQQSILRNRI AGLGKNRKTA VFPKLVFAIR DGLNHKAGDA       360
     NYDIKQLALE CASKRMYPDI LNYDQVVKVT GSFKTPMGCR SFLGVYEENG EMIHEGRNNI       420
     GVISLNLPRI ALEAKRDEAA FWTLLDERLL LAKKALMTRI ARLEGIKARV APILYMEGAC       480
     GVRLKADDDI SGIFKNGRAS ISLGYIGVHE TINALFGDQT HVFDASQLRE KAVAIVARLK       540
     AATDSWKDET GYGFSLYSTP SENLCDRFCR LDKAEFGLVA GVTDKGYYTN SFHLDVEKKV       600
     NPYEKLDFEA PYPPLSNGGF ICYGEYPNLQ HNLKALEDVW DYSYTRVPYY GTNTPIDECY       660
     DCGYTGEFEC TSKGFTCPKC GNHEPSRVSV TRRVCGYLGS PDARPFNAGK QEEVKRRIKH       720
     LGNGQLG                                                                 727
//

If you have problems or comments...

PBIL Back to PBIL home page