(data stored in SCRATCH zone)

EMBL: CP002505.PE516

CP002505.PE516       Location/Qualifiers
FT   CDS             complement(554630..555586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0521"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="TIGRFAM: trehalose operon repressor; PFAM:
FT                   regulatory protein LacI; periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: yen:YE3775 trehalose
FT                   repressor; SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72149"
FT                   /db_xref="GOA:A0A0H3F865"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012771"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F865"
FT                   /inference="protein motif:TFAM:TIGR02405"
FT                   /protein_id="ADW72149.1"
FT                   /translation="MTQQNRLTINDIARLSGVGKSTVSRVLNNEGNVSPQTRERVLQVI
FT                   EQQHFSPSKSARAMRGFSDKIVAIIVSRLDSPSENLAVRAMLPLFYQQGYDPIVLESQF
FT                   SAERVKEHLQVLKQRNIDGIVLFGFTGLSAQMLTPWQDKMVVLARDMPGLSSVCYDDAG
FT                   AVQLLMQKLLAQNIREIGFIGVSPQDTTTGQRRSAAFRTFCKEHGLTPHIALGELTYQS
FT                   GFDLIPQLLKNNIQAVVCASDTIAIGAQKYLQQQQIRGVQVCGIGNNPLLHFLFPESYS
FT                   VELGYGAGGEAAAKQLLAQLSGSTTVRQLIIPGKLAF"
     MTQQNRLTIN DIARLSGVGK STVSRVLNNE GNVSPQTRER VLQVIEQQHF SPSKSARAMR        60
     GFSDKIVAII VSRLDSPSEN LAVRAMLPLF YQQGYDPIVL ESQFSAERVK EHLQVLKQRN       120
     IDGIVLFGFT GLSAQMLTPW QDKMVVLARD MPGLSSVCYD DAGAVQLLMQ KLLAQNIREI       180
     GFIGVSPQDT TTGQRRSAAF RTFCKEHGLT PHIALGELTY QSGFDLIPQL LKNNIQAVVC       240
     ASDTIAIGAQ KYLQQQQIRG VQVCGIGNNP LLHFLFPESY SVELGYGAGG EAAAKQLLAQ       300
     LSGSTTVRQL IIPGKLAF                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page