(data stored in SCRATCH zone)

EMBL: CP002505.PE518

CP002505.PE518       Location/Qualifiers
FT   CDS             complement(558711..559685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0523"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   eay:EAM_0499 protein Alx ( high pH-induced membrane-bound
FT                   redox modulator)"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72151"
FT                   /db_xref="GOA:A0A0H3FAT3"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAT3"
FT                   /inference="protein motif:PFAM:PF03741"
FT                   /protein_id="ADW72151.1"
FT                   /translation="MMNSVGNPMLWGSFAVVVIIMLAFDLLLQGRKGAQTMSMKSAAMW
FT                   SLVWIGLSLLFNFGFWWYLNGEFGREVADAKATMFLTGYLLEKALAVDNVFVWLILFSY
FT                   FSIPASLQRRVLVYGVLGAIVLRTGMIFAGSWLVGQFSWILYVFGAFLLFTGIKMALAK
FT                   EEDGEVGEKPMIRWLRSKMRMTDELQGEKFFVRRNGILFATPLLLVLIMVELSDVIFAV
FT                   DSIPAIFAVTTDPFIVLTSNLFAILGLRAMYFLLAGVAERFSMLKYGLAVILIFIGIKM
FT                   LLLDVFHIPVGISLGVIASILIITLLINTWVNRRNDRKNNAQS"
     MMNSVGNPML WGSFAVVVII MLAFDLLLQG RKGAQTMSMK SAAMWSLVWI GLSLLFNFGF        60
     WWYLNGEFGR EVADAKATMF LTGYLLEKAL AVDNVFVWLI LFSYFSIPAS LQRRVLVYGV       120
     LGAIVLRTGM IFAGSWLVGQ FSWILYVFGA FLLFTGIKMA LAKEEDGEVG EKPMIRWLRS       180
     KMRMTDELQG EKFFVRRNGI LFATPLLLVL IMVELSDVIF AVDSIPAIFA VTTDPFIVLT       240
     SNLFAILGLR AMYFLLAGVA ERFSMLKYGL AVILIFIGIK MLLLDVFHIP VGISLGVIAS       300
     ILIITLLINT WVNRRNDRKN NAQS                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page