(data stored in SCRATCH zone)

EMBL: CP002505.PE520

CP002505.PE520       Location/Qualifiers
FT   CDS             complement(560756..561742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0525"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   spe:Spro_4316 oxidoreductase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72153"
FT                   /db_xref="GOA:A0A0H3F5G3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5G3"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADW72153.1"
FT                   /translation="MIRIGVVGTNWITQRFIDAAHESGKMKLTAIYSRTLEGAKKLGED
FT                   YPVEHYFDSLEAMAASDLIDAVYIASPNSLHYPQSLLFLSNKKHVICEKPLASNLREAE
FT                   SLIACAKENNVVLFEAFKTAYLPNFLHMKGALNRIGKLRKAILNYCQYSSRYPRYLAGE
FT                   NPNTFNPAFSNGSIMDIGYYCLASAISLFGEPESVKATATLLESGVDGQGTVILSYADD
FT                   FEVVINHSKISDSLLPSEIQGEDGTLQMEKLSECQTLSLTPRGSQKLDLTQPQHINTML
FT                   YEAETFAILVDSQFVAHPGLEVSRITAKVLTEIRRQTGVVFPADNQP"
     MIRIGVVGTN WITQRFIDAA HESGKMKLTA IYSRTLEGAK KLGEDYPVEH YFDSLEAMAA        60
     SDLIDAVYIA SPNSLHYPQS LLFLSNKKHV ICEKPLASNL REAESLIACA KENNVVLFEA       120
     FKTAYLPNFL HMKGALNRIG KLRKAILNYC QYSSRYPRYL AGENPNTFNP AFSNGSIMDI       180
     GYYCLASAIS LFGEPESVKA TATLLESGVD GQGTVILSYA DDFEVVINHS KISDSLLPSE       240
     IQGEDGTLQM EKLSECQTLS LTPRGSQKLD LTQPQHINTM LYEAETFAIL VDSQFVAHPG       300
     LEVSRITAKV LTEIRRQTGV VFPADNQP                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page