(data stored in SCRATCH zone)

EMBL: CP002505.PE535

CP002505.PE535       Location/Qualifiers
FT   CDS             585780..586889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0540"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: spe:Spro_4470 maltose/maltodextrin transporter
FT                   ATP-binding protein; PFAM: ABC transporter related;
FT                   Transport-associated OB domain-containing protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72168"
FT                   /db_xref="GOA:A0A0H3F5K1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR015855"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5K1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADW72168.1"
FT                   /translation="MASVSLNSVYKAFGDTVISSDINLEIEEGEFVVFVGPSGCGKSTL
FT                   LRMIAGLEDITSGELKIGDKRMNEVPPADRGIGMVFQSYALYPHLSVAENMSFGLKLAG
FT                   AKKAEINQRVNQVSEVLQLAHLLDRRPKALSGGQRQRVAIGRTLVAEPTVFLLDEPLSN
FT                   LDAALRVQMRIEISRLHKRLKRTMIYVTHDQVEAMTLADKIVVLDAGHIAQVGKPLELY
FT                   HYPANRFVAGFIGSPKMNFLPVKVTAAEPARVQVELPNRQQVWLPVEGTDVKVGSNLSL
FT                   GIRPEHLLPSDVAEVTLSGEVQVVEQLGNETQIHIQIPAIRQNLVYRQNDVVLVEEGAT
FT                   FAIGLPPHRCHLFREDGTACRRLHPEPGV"
     MASVSLNSVY KAFGDTVISS DINLEIEEGE FVVFVGPSGC GKSTLLRMIA GLEDITSGEL        60
     KIGDKRMNEV PPADRGIGMV FQSYALYPHL SVAENMSFGL KLAGAKKAEI NQRVNQVSEV       120
     LQLAHLLDRR PKALSGGQRQ RVAIGRTLVA EPTVFLLDEP LSNLDAALRV QMRIEISRLH       180
     KRLKRTMIYV THDQVEAMTL ADKIVVLDAG HIAQVGKPLE LYHYPANRFV AGFIGSPKMN       240
     FLPVKVTAAE PARVQVELPN RQQVWLPVEG TDVKVGSNLS LGIRPEHLLP SDVAEVTLSG       300
     EVQVVEQLGN ETQIHIQIPA IRQNLVYRQN DVVLVEEGAT FAIGLPPHRC HLFREDGTAC       360
     RRLHPEPGV                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page