(data stored in SCRATCH zone)

EMBL: CP002505.PE536

CP002505.PE536       Location/Qualifiers
FT   CDS             586919..588214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0541"
FT                   /product="porin LamB type"
FT                   /note="PFAM: porin LamB type; KEGG: ebi:EbC_44660
FT                   maltoporin"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72169"
FT                   /db_xref="GOA:A0A0H3F8A1"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR023738"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F8A1"
FT                   /inference="protein motif:PFAM:PF02264"
FT                   /protein_id="ADW72169.1"
FT                   /translation="MITMRSSSLALAVAAGILSTQAMAVDFTGYARSGIGWTGSGGEQQ
FT                   CFKATGADSKYRLGNECETYAELKLGQEVWKEGDKSFYFDTNVAYSVSQQNDWESTDPA
FT                   FREANVKGKNLIEWLPGSTMWAGKRFYQRHDVHMIDFYYWDISGPGAGLEDIDLGFGKL
FT                   SLAATRNTESGGSYGYIADQRNEVPTSNDVFDVRLAGLQTNPGGVLELGVDYGRANARD
FT                   GYSLADDATKDGFLVTAEHTQSIYNGYNKFVLQYAADSMTDPGQGAANGHSNGAAINNN
FT                   GSMVRVLDHGAIDFNDTWSLMYVAMYQDVDRDNNNGTTWYTVGVRPMYKWTPIMSTLLE
FT                   VGYDNVKSQRTGDKNGQYKVTLAQQWQAGDSIWSRPAIRVFATYANWDEKWGYDTDSGA
FT                   NNGLAMNDTSTTTYSRGNDDEITFGAQMEIWW"
     MITMRSSSLA LAVAAGILST QAMAVDFTGY ARSGIGWTGS GGEQQCFKAT GADSKYRLGN        60
     ECETYAELKL GQEVWKEGDK SFYFDTNVAY SVSQQNDWES TDPAFREANV KGKNLIEWLP       120
     GSTMWAGKRF YQRHDVHMID FYYWDISGPG AGLEDIDLGF GKLSLAATRN TESGGSYGYI       180
     ADQRNEVPTS NDVFDVRLAG LQTNPGGVLE LGVDYGRANA RDGYSLADDA TKDGFLVTAE       240
     HTQSIYNGYN KFVLQYAADS MTDPGQGAAN GHSNGAAINN NGSMVRVLDH GAIDFNDTWS       300
     LMYVAMYQDV DRDNNNGTTW YTVGVRPMYK WTPIMSTLLE VGYDNVKSQR TGDKNGQYKV       360
     TLAQQWQAGD SIWSRPAIRV FATYANWDEK WGYDTDSGAN NGLAMNDTST TTYSRGNDDE       420
     ITFGAQMEIW W                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page