(data stored in SCRATCH zone)

EMBL: CP002505.PE550

CP002505.PE550       Location/Qualifiers
FT   CDS             604749..605114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0556"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aci:ACIAD0051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72183"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5L7"
FT                   /inference="similar to AA sequence:KEGG:ACIAD0051"
FT                   /protein_id="ADW72183.1"
FT                   /translation="MEEAKKVKSVHPLALEGSRTKRGGVVRVQEREDHIYFGEGRHRLA
FT                   HVGDEVVYPDGSVSCIVSGAGYGFAYRGFPAAIIGSEAENGDVIEWLPDTGIAAEIHVP
FT                   EEGIEGFLVRGYSAPWK"
     MEEAKKVKSV HPLALEGSRT KRGGVVRVQE REDHIYFGEG RHRLAHVGDE VVYPDGSVSC        60
     IVSGAGYGFA YRGFPAAIIG SEAENGDVIE WLPDTGIAAE IHVPEEGIEG FLVRGYSAPW       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page