(data stored in SCRATCH zone)

EMBL: CP002505.PE59

CP002505.PE59        Location/Qualifiers
FT   CDS             64064..64516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0059"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sgl:SG1755 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71692"
FT                   /db_xref="GOA:A0A0H3F4M1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4M1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADW71692.1"
FT                   /translation="MSQPQDVMIRLLTPADREGWEALWRDYLDFYQSELDPAQFDYTFQ
FT                   RLSQPDYASMFGYVAEYEGKLVGLVNCINHDHGWHMQQVVYLQDLYVDDRARKLGIGQK
FT                   LIEAVYAYADENNKANVYWTTQTSNHTARKLYDRIGTLTEFIKYSR"
     MSQPQDVMIR LLTPADREGW EALWRDYLDF YQSELDPAQF DYTFQRLSQP DYASMFGYVA        60
     EYEGKLVGLV NCINHDHGWH MQQVVYLQDL YVDDRARKLG IGQKLIEAVY AYADENNKAN       120
     VYWTTQTSNH TARKLYDRIG TLTEFIKYSR                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page