(data stored in SCRATCH zone)

EMBL: CP002505.PE63

CP002505.PE63        Location/Qualifiers
FT   CDS             complement(66330..66776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0063"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hch:HCH_01386 histone acetyltransferase HPA2-like
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71696"
FT                   /db_xref="GOA:A0A0H3F9C0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9C0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADW71696.1"
FT                   /translation="MKTRLTHAPTESDLEEIKTALRDFNRNFIPKPTFRELGIFVEDEN
FT                   GKKLAGIVAETVGYWMYIKMLWVDETLRGKDVGTQLIREAEEEAKARGCRYSLVDTFSF
FT                   QARPFYERMGYSMQMALEDYLPDSRAPDDAPSTHTRFFLTKTLS"
     MKTRLTHAPT ESDLEEIKTA LRDFNRNFIP KPTFRELGIF VEDENGKKLA GIVAETVGYW        60
     MYIKMLWVDE TLRGKDVGTQ LIREAEEEAK ARGCRYSLVD TFSFQARPFY ERMGYSMQMA       120
     LEDYLPDSRA PDDAPSTHTR FFLTKTLS                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page