(data stored in SCRATCH zone)

EMBL: CP002505.PE64

CP002505.PE64        Location/Qualifiers
FT   CDS             complement(66796..67431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0064"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   pct:PC1_4180 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71697"
FT                   /db_xref="GOA:A0A0H3F4M4"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4M4"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADW71697.1"
FT                   /translation="MTVTESLLSYALAAGILTLTPGLDTALVLRTAASQGSKKALSTAF
FT                   GISTGCLVWGAMVALGLGAVLAASEIAFNVLKWIGAAYLAWLGLQMLFKPRNEMNMDAP
FT                   QSRRTALRIGNSPFVKGLFGNVLNPKVGVFYVSFLPQFVATGYPVGPYIFGLAAMHAVI
FT                   GTLWSVTMISATRPLSRWLRRPAVVRTLDRLTGTVFIAFAVRLATTKR"
     MTVTESLLSY ALAAGILTLT PGLDTALVLR TAASQGSKKA LSTAFGISTG CLVWGAMVAL        60
     GLGAVLAASE IAFNVLKWIG AAYLAWLGLQ MLFKPRNEMN MDAPQSRRTA LRIGNSPFVK       120
     GLFGNVLNPK VGVFYVSFLP QFVATGYPVG PYIFGLAAMH AVIGTLWSVT MISATRPLSR       180
     WLRRPAVVRT LDRLTGTVFI AFAVRLATTK R                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page