(data stored in SCRATCH zone)

EMBL: CP002505.PE68

CP002505.PE68        Location/Qualifiers
FT   CDS             complement(68946..69362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0068"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afr:AFE_0010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71701"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9C3"
FT                   /inference="similar to AA sequence:KEGG:AFE_0010"
FT                   /protein_id="ADW71701.1"
FT                   /translation="MAPMTRFDAALKRGEQTANDPSRPVSVEYRPEQHAFMIMHGNGVG
FT                   YLINIDLIEELQHATQEQLNTAAVDGFSKALRIPACNVDIYLPGLLAKILFDASDLQKI
FT                   VASINGAMRSAVKASASRENGKKGGRPRKNTELR"
     MAPMTRFDAA LKRGEQTAND PSRPVSVEYR PEQHAFMIMH GNGVGYLINI DLIEELQHAT        60
     QEQLNTAAVD GFSKALRIPA CNVDIYLPGL LAKILFDASD LQKIVASING AMRSAVKASA       120
     SRENGKKGGR PRKNTELR                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page