(data stored in SCRATCH zone)

EMBL: CP002505.PE7

CP002505.PE7         Location/Qualifiers
FT   CDS             complement(8492..8869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0007"
FT                   /product="protein of unknown function DUF1375"
FT                   /note="PFAM: protein of unknown function DUF1375; KEGG:
FT                   pct:PC1_0033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71640"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F3B1"
FT                   /inference="protein motif:PFAM:PF07119"
FT                   /protein_id="ADW71640.1"
FT                   /translation="MTKFALTPLMTGCVFLATSGCSSVMSHTGGDTGYYSGARADVNMI
FT                   KSDDTSWAMTPLLLIDLPFSAVLDTVLLPYDYFRSGKVTTRDRVKASEEHNIALSNGVD
FT                   IDHIPPMTTTPRQQKSSTHKK"
     MTKFALTPLM TGCVFLATSG CSSVMSHTGG DTGYYSGARA DVNMIKSDDT SWAMTPLLLI        60
     DLPFSAVLDT VLLPYDYFRS GKVTTRDRVK ASEEHNIALS NGVDIDHIPP MTTTPRQQKS       120
     STHKK                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page