(data stored in SCRATCH zone)

EMBL: CP002505.PE73

CP002505.PE73        Location/Qualifiers
FT   CDS             complement(73885..75153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0073"
FT                   /product="urea ABC transporter, urea binding protein"
FT                   /note="KEGG: ebi:EbC_06370 ABC transporter subunit,
FT                   substrate-binding (UrtA-like); TIGRFAM: urea ABC
FT                   transporter, urea binding protein; PFAM: Extracellular
FT                   ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71706"
FT                   /db_xref="GOA:A0A0H3F9C7"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR017777"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F9C7"
FT                   /inference="protein motif:TFAM:TIGR03407"
FT                   /protein_id="ADW71706.1"
FT                   /translation="MQRRRFIKAFALSATVVSMGLAWSAQAAETIKVGIMHSLSGTMAI
FT                   SETPLKDIALMTIDDINAKGGVLGKKLEPVVVDPASNWPLFAEKARQLLTQDKVAVVFG
FT                   CWTSVSRKSVLPVFEELNGLLFYPVQYEGEEMSPNVFYTGAAPNQQAIPAVEYLMSEDG
FT                   GAAKRFFLLGTDYVYPRTTNKILRAFLHSKGVKDSDIEEVYTPFGYSDYQTIVSNIKKF
FT                   SAGGKTAVISTINGDSNVPFYKELANQGVKATDVPVVAFSVGEEELRGIDTKPLVGDLA
FT                   AWNYFQSVDNPTNKKFVAEWKAYAKAHKLPNADNAVTNDPMEATYVGIHMWAQAVEKAG
FT                   TTDVDKVRAAMAGQTFAAPSGFTLTMDKTNHHLHKPVMIGEIESNGQFNVVWQTDKPIR
FT                   AQPWSPYIAGNDKKPDTPVKTTN"
     MQRRRFIKAF ALSATVVSMG LAWSAQAAET IKVGIMHSLS GTMAISETPL KDIALMTIDD        60
     INAKGGVLGK KLEPVVVDPA SNWPLFAEKA RQLLTQDKVA VVFGCWTSVS RKSVLPVFEE       120
     LNGLLFYPVQ YEGEEMSPNV FYTGAAPNQQ AIPAVEYLMS EDGGAAKRFF LLGTDYVYPR       180
     TTNKILRAFL HSKGVKDSDI EEVYTPFGYS DYQTIVSNIK KFSAGGKTAV ISTINGDSNV       240
     PFYKELANQG VKATDVPVVA FSVGEEELRG IDTKPLVGDL AAWNYFQSVD NPTNKKFVAE       300
     WKAYAKAHKL PNADNAVTND PMEATYVGIH MWAQAVEKAG TTDVDKVRAA MAGQTFAAPS       360
     GFTLTMDKTN HHLHKPVMIG EIESNGQFNV VWQTDKPIRA QPWSPYIAGN DKKPDTPVKT       420
     TN                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page