(data stored in SCRATCH zone)

EMBL: CP002505.PE91

CP002505.PE91        Location/Qualifiers
FT   CDS             complement(95545..96984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0092"
FT                   /product="amidohydrolase"
FT                   /note="KEGG: ebi:EbC_07580 aminobenzoyl-glutamate
FT                   utilization family protein; TIGRFAM: amidohydrolase; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71724"
FT                   /db_xref="GOA:A0A0H3F730"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR017145"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F730"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ADW71724.1"
FT                   /translation="MNNASAQNKETVWSLVDAKKALFTALSDRVWGMPEICYTEYRSVA
FT                   EHTAMLKEQGFRVTENVADIPTAVMGEAGEGGPIIAILGEYDALPGLSQVAGIARPEPL
FT                   PGNGQGHGCGHNLLGSAAMLAATALKDWLAQTGTPGRVRYYGCPAEEGGAAKSFMARAG
FT                   AFDGVDIAITWHPNAFTEVARAESLANTRMDFVFHGRSSHAAASPHLGRSALDAVELMN
FT                   VGVNYLREHVPQDSRIHYAMLDSGGIAPNVVQARAAVRYAIRSRDVHAMFELNERVKKV
FT                   AQGAALMTETTVDISIMSAVANLLGNRPLEEAMQRNFELLGPLEFDAADKAFAAEIQAT
FT                   LSPQDLQSAYRRIGLKKPQDASPLCEFIVPLETSGELMLGSTDVGDISWKMPTVQAHVP
FT                   TYAIGTPGHSWQLTAQGKMPAAHKGLAYVAKIMAATAIDTLTDSALMAAAKQAHQELTA
FT                   ETPYVCPIPPEVKPPVQPRPE"
     MNNASAQNKE TVWSLVDAKK ALFTALSDRV WGMPEICYTE YRSVAEHTAM LKEQGFRVTE        60
     NVADIPTAVM GEAGEGGPII AILGEYDALP GLSQVAGIAR PEPLPGNGQG HGCGHNLLGS       120
     AAMLAATALK DWLAQTGTPG RVRYYGCPAE EGGAAKSFMA RAGAFDGVDI AITWHPNAFT       180
     EVARAESLAN TRMDFVFHGR SSHAAASPHL GRSALDAVEL MNVGVNYLRE HVPQDSRIHY       240
     AMLDSGGIAP NVVQARAAVR YAIRSRDVHA MFELNERVKK VAQGAALMTE TTVDISIMSA       300
     VANLLGNRPL EEAMQRNFEL LGPLEFDAAD KAFAAEIQAT LSPQDLQSAY RRIGLKKPQD       360
     ASPLCEFIVP LETSGELMLG STDVGDISWK MPTVQAHVPT YAIGTPGHSW QLTAQGKMPA       420
     AHKGLAYVAK IMAATAIDTL TDSALMAAAK QAHQELTAET PYVCPIPPEV KPPVQPRPE        479
//

If you have problems or comments...

PBIL Back to PBIL home page