(data stored in ACNUC13479 zone)

EMBL: CP002688.ACI1

CP002688.ACI1        Location/Qualifiers
FT   CDS             join(152575..153523,153961..154295)
FT                   /codon_start=1
FT                   /gene="ACI1"
FT                   /gene_synonym="ALC-interacting protein 1"
FT                   /gene_synonym="T10O8.80"
FT                   /gene_synonym="T10O8_80"
FT                   /gene_synonym="TON1 Recruiting Motif 29"
FT                   /gene_synonym="TRM29"
FT                   /locus_tag="AT5G01370"
FT                   /product="ALC-interacting protein 1"
FT                   /note="ALC-interacting protein 1 (ACI1); Has 1807 Blast
FT                   hits to 1807 proteins in 277 species: Archae - 0; Bacteria
FT                   - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0;
FT                   Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M035"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M035"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG501526.1,INSD:DR297132.1,INSD:ES031379.1,
FT                   INSD:EG501536.1,INSD:EL159890.1,INSD:EG501527.1,
FT                   INSD:EG456881.1,INSD:DR355559.1,INSD:ES100852.1,
FT                   INSD:EH848113.1,INSD:EG456880.1,INSD:ES086872.1,
FT                   INSD:DR382153.1,INSD:EL016085.1,INSD:ES145943.1,
FT                   INSD:EG501537.1,INSD:ES139644.1,INSD:DR380950.1,
FT                   INSD:EL126278.1,INSD:ES012991.1,INSD:EL991033.1,
FT                   INSD:EH870662.1,INSD:DR381859.1,INSD:EH823594.1,
FT                   INSD:DR355560.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX829513.1,INSD:BT030028.1"
FT                   /protein_id="AED90333.1"
FT                   /translation="MTQRANPKTGCLTAVVRRLLCSGSQQTHPSDNILDSDETLQLLIS
FT                   YEENEEPKKEIKTETETQNDDVSLHPPPPPPPPNVVAKLMGLDHPAPGSKRFRYFDDSG
FT                   SAVTRSKSVNFMDYILKGHEEEEENEDEKDGQRQCRRVKASVSFREIVPTSARWSSNNQ
FT                   QKKHDFLLLYLDKLDEKRELVGSSSFSRSKRFEKVVEDSKKPPLPPSAPKKKENEKVAK
FT                   KFKDEPRKVAKKKKSENRNDVNGAKKVRWFLSPSKSKSSSEKTALLGESKNIRADEFIG
FT                   KESESPENKSNASPVSVLDRDLYDYLILDDDYYFSGGDSESASELSTKQVETATKSSCS
FT                   SSPAKTKTSTKKENNNSTNNDSEETEFITKLMNMLSDLSEEDMKSSTWVSTSSTKPVDF
FT                   TQVEDFCVEFGQEILDLVMDQLVDELCI"
     MTQRANPKTG CLTAVVRRLL CSGSQQTHPS DNILDSDETL QLLISYEENE EPKKEIKTET        60
     ETQNDDVSLH PPPPPPPPNV VAKLMGLDHP APGSKRFRYF DDSGSAVTRS KSVNFMDYIL       120
     KGHEEEEENE DEKDGQRQCR RVKASVSFRE IVPTSARWSS NNQQKKHDFL LLYLDKLDEK       180
     RELVGSSSFS RSKRFEKVVE DSKKPPLPPS APKKKENEKV AKKFKDEPRK VAKKKKSENR       240
     NDVNGAKKVR WFLSPSKSKS SSEKTALLGE SKNIRADEFI GKESESPENK SNASPVSVLD       300
     RDLYDYLILD DDYYFSGGDS ESASELSTKQ VETATKSSCS SSPAKTKTST KKENNNSTNN       360
     DSEETEFITK LMNMLSDLSE EDMKSSTWVS TSSTKPVDFT QVEDFCVEFG QEILDLVMDQ       420
     LVDELCI                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page