(data stored in ACNUC13479 zone)

EMBL: CP002688.AIRP2

CP002688.AIRP2       Location/Qualifiers
FT   CDS             join(206797..206861,207453..207603,207703..207769,
FT                   207867..208101,208189..208399)
FT                   /codon_start=1
FT                   /gene="AIRP2"
FT                   /gene_synonym="F7A7.40"
FT                   /gene_synonym="F7A7_40"
FT                   /gene_synonym="ABA Insensitive RING Protein 2"
FT                   /gene_synonym="AtAIRP2"
FT                   /locus_tag="AT5G01520"
FT                   /product="RING/U-box superfamily protein"
FT                   /note="RING/U-box superfamily protein; FUNCTIONS IN: zinc
FT                   ion binding; EXPRESSED IN: 17 plant structures; EXPRESSED
FT                   DURING: 8 growth stages; CONTAINS InterPro DOMAIN/s: Zinc
FT                   finger, RING-type, conserved site (InterPro:IPR017907),
FT                   Zinc finger, RING-type (InterPro:IPR001841), Zinc finger,
FT                   C3HC4 RING-type (InterPro:IPR018957); BEST Arabidopsis
FT                   thaliana protein match is: RING/U-box superfamily protein
FT                   (TAIR:AT3G47160.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M022"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M022"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES200245.1,INSD:CB257492.1,INSD:AV557717.1,
FT                   INSD:ES024579.1,INSD:T22636.1,INSD:BP671900.1,
FT                   INSD:BP843186.1,INSD:AV826358.1,INSD:BU635339.1,
FT                   INSD:ES071674.1,INSD:AV794566.1,INSD:AA712150.1,
FT                   INSD:ES152097.1,INSD:AV564168.1,INSD:ES113693.1,
FT                   INSD:BP856644.1,INSD:BP663168.1,INSD:AV827590.1,
FT                   INSD:CK118139.1,INSD:ES004530.1,INSD:ES019253.1,
FT                   INSD:BP661628.1,INSD:EH934658.1,INSD:BP660462.1,
FT                   INSD:EL295849.1,INSD:N96366.1,INSD:T43550.1,
FT                   INSD:BP804842.1,INSD:ES089210.1,INSD:ES086864.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:DQ059129.1,INSD:AY050835.1,INSD:AY091165.1"
FT                   /protein_id="AED90356.1"
FT                   /translation="MRKSFKDSLKALEADIQFANTLASEYPEEYDGGYVQMRLSYSPAA
FT                   HLFLFLLQWTDCHFAGALGLLRILIYKAYVDGKTTMSLHERKTSIREFYDVLFPSLLQL
FT                   HGGITDVEERKQKEICDKRYRKKDRTDKGKMSEIDLEREEECGICLEIRNKVVLPTCNH
FT                   SMCINCYRNWRARSQSCPFCRGSLKRVNSGDLWIYTCSAEIADLPAIYKENLKRLLIYI
FT                   DKLPLVTSDPNLVPYAPLPR"
     MRKSFKDSLK ALEADIQFAN TLASEYPEEY DGGYVQMRLS YSPAAHLFLF LLQWTDCHFA        60
     GALGLLRILI YKAYVDGKTT MSLHERKTSI REFYDVLFPS LLQLHGGITD VEERKQKEIC       120
     DKRYRKKDRT DKGKMSEIDL EREEECGICL EIRNKVVLPT CNHSMCINCY RNWRARSQSC       180
     PFCRGSLKRV NSGDLWIYTC SAEIADLPAI YKENLKRLLI YIDKLPLVTS DPNLVPYAPL       240
     PR                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page