(data stored in ACNUC13479 zone)

EMBL: CP002688.APD2

CP002688.APD2        Location/Qualifiers
FT   CDS             complement(join(183693..183768,183891..184194,
FT                   184298..184370,184515..184661,184819..184901,
FT                   184989..185063,185419..185512,185591..185716,
FT                   185803..185909,185995..186244))
FT                   /codon_start=1
FT                   /gene="APD2"
FT                   /gene_synonym="T10O8.160"
FT                   /gene_synonym="T10O8_160"
FT                   /gene_synonym="ABERRANT POLLEN DEVELOPMENT 2"
FT                   /locus_tag="AT5G01450"
FT                   /product="RING/U-box superfamily protein"
FT                   /note="RING/U-box superfamily protein; FUNCTIONS IN: zinc
FT                   ion binding; INVOLVED IN: biological_process unknown;
FT                   LOCATED IN: cellular_component unknown; EXPRESSED IN: 24
FT                   plant structures; EXPRESSED DURING: 11 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Zinc finger, RING-type
FT                   (InterPro:IPR001841); BEST Arabidopsis thaliana protein
FT                   match is: RING/U-box superfamily protein
FT                   (TAIR:AT2G38185.2); Has 1494 Blast hits to 1490 proteins in
FT                   181 species: Archae - 0; Bacteria - 0; Metazoa - 838; Fungi
FT                   - 48; Plants - 298; Viruses - 88; Other Eukaryotes - 222
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q6DBH0"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR032008"
FT                   /db_xref="InterPro:IPR032010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DBH0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BE529281.1,INSD:ES116463.1,INSD:CF773968.1,
FT                   INSD:AV518482.1,INSD:EG512545.1,INSD:AA651416.1,
FT                   INSD:EL237213.1,INSD:AV439912.1,INSD:ES149332.1,
FT                   INSD:AU237497.1,INSD:EH867362.1,INSD:ES122109.1,
FT                   INSD:EL068859.1,INSD:AV525674.1,INSD:CF773035.1,
FT                   INSD:ES137837.1,INSD:AU228571.1,INSD:BU635166.1,
FT                   INSD:DR353056.1,INSD:AV534498.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT015052.1,INSD:BT015858.1,INSD:AK229004.1,
FT                   INSD:BX831291.1"
FT                   /protein_id="AED90346.1"
FT                   /translation="MSLPDSLPSSSSSPPVTREETGFHRFEHHGNDSGFDHRDRPPWNR
FT                   SEYDYRHGSVVASENVRNNSTSEDPWSCVVVVATFCIFVSMTLILGLYGTTNVWLGPNS
FT                   SFLIKPTSVFVQNVIVEELGNKGSGLILYGLNQAPQLDVLTKWSEVHYLAVPNDSYKYW
FT                   IQYLNKGSRVKVSYNVESVGSSLYLVIAQGVDGLSEWVQDPTRPDTTLSWHIISDSGYI
FT                   EQDITKSSSYYVAVGNVYLNEVKATIDIQVEGVLYDTTNAYYNCSFPNDKCTLSVPLFG
FT                   TNAAVLTSPGPKLNNSKNEFCAKLSYEPRWIAYIVCMGVVTALLLIVSSLFNKRQPVTE
FT                   DETVDENDDVAPLIPGKDDDNSSWCSSYSSILTSTEELEGAHGEGHSSTRYLCAICYDA
FT                   PRDCFFLSCGHCVACFQCGTRIAETSGFCPVCRKKIRKVKKIFNV"
     MSLPDSLPSS SSSPPVTREE TGFHRFEHHG NDSGFDHRDR PPWNRSEYDY RHGSVVASEN        60
     VRNNSTSEDP WSCVVVVATF CIFVSMTLIL GLYGTTNVWL GPNSSFLIKP TSVFVQNVIV       120
     EELGNKGSGL ILYGLNQAPQ LDVLTKWSEV HYLAVPNDSY KYWIQYLNKG SRVKVSYNVE       180
     SVGSSLYLVI AQGVDGLSEW VQDPTRPDTT LSWHIISDSG YIEQDITKSS SYYVAVGNVY       240
     LNEVKATIDI QVEGVLYDTT NAYYNCSFPN DKCTLSVPLF GTNAAVLTSP GPKLNNSKNE       300
     FCAKLSYEPR WIAYIVCMGV VTALLLIVSS LFNKRQPVTE DETVDENDDV APLIPGKDDD       360
     NSSWCSSYSS ILTSTEELEG AHGEGHSSTR YLCAICYDAP RDCFFLSCGH CVACFQCGTR       420
     IAETSGFCPV CRKKIRKVKK IFNV                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page