(data stored in ACNUC13479 zone)

EMBL: CP002688.APTX

CP002688.APTX        Location/Qualifiers
FT   CDS             join(126329..126502,126668..127539,127617..128214,
FT                   128300..128470,128643..128960)
FT                   /codon_start=1
FT                   /gene="APTX"
FT                   /gene_synonym="APRATAXIN-like"
FT                   /gene_synonym="T10O8.20"
FT                   /gene_synonym="T10O8_20"
FT                   /locus_tag="AT5G01310"
FT                   /product="APRATAXIN-like protein"
FT                   /note="APRATAXIN-like (APTX); FUNCTIONS IN:
FT                   adenylylsulfatase activity, sequence-specific DNA binding
FT                   transcription factor activity; INVOLVED IN: sulfur
FT                   metabolic process, purine ribonucleotide metabolic process,
FT                   regulation of transcription; LOCATED IN: intracellular,
FT                   nucleus, chloroplast; EXPRESSED IN: 11 plant structures;
FT                   EXPRESSED DURING: 4 anthesis, C globular stage, petal
FT                   differentiation and expansion stage, E expanded cotyledon
FT                   stage, D bilateral stage; CONTAINS InterPro DOMAIN/s: Zinc
FT                   finger, C2H2-like (InterPro:IPR015880), Appr-1-p processing
FT                   (InterPro:IPR002589), Histidine triad (HIT) protein
FT                   (InterPro:IPR001310), Helix-loop-helix DNA-binding domain
FT                   (InterPro:IPR001092), Histidine triad motif
FT                   (InterPro:IPR011151), Helix-loop-helix DNA-binding
FT                   (InterPro:IPR011598), Histidine triad-like motif
FT                   (InterPro:IPR011146), Histidine triad, conserved site
FT                   (InterPro:IPR019808); BEST Arabidopsis thaliana protein
FT                   match is: basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein (TAIR:AT3G21330.1); Has 1807 Blast hits
FT                   to 1807 proteins in 277 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0;
FT                   Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:A0A2H1ZE58"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032566"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2H1ZE58"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL019604.1,INSD:EH947045.1,INSD:ES105740.1,
FT                   INSD:ES082029.1,INSD:EH948278.1,INSD:BP788122.1,
FT                   INSD:EL248113.1,INSD:EL300374.1,INSD:EL251986.1"
FT                   /protein_id="AED90326.2"
FT                   /translation="MEVQIEESGKNQTSPESIEADKAKQIVVLLIGPPGSGKSTFCDTA
FT                   MRSSHRPWSRICQDIVNNGKAGTKAQCLKMATDSLREGKSVFIDRCNLDREQRSEFIKL
FT                   GGPEFEVHAVVLELPAQVCISRSVKRTGHEGNLQGGRAAAVVNKMLQSKELPKVNEGFS
FT                   RIMFCYSDADVDNAVNMYNKLGPMDTLPSGCFGEKKLDTKSQPGIMKFFKKVSALPASS
FT                   SNEATNTTRKADEMTANVRVSPVKLGSADIVPTLAFPSISTADFQFDLEKASDIIVEKA
FT                   EEFLSKLGTARLVLVDLSRGSKILSLVKAKASQKNIDSAKFFTFVGDITKLRSEGGLHC
FT                   NVIANATNWRLKPGGGGVNAAIFKAAGPDLETATRVRANTLLPGKAVVVPLPSTCPLHN
FT                   AEGITHVIHVLGPNMNPNRPDNLNNDYTKGCKTLREAYTSLFEGFLSVVQDQSKLPKRS
FT                   SQTAVSDSGEDIKEDSERNKKYKGSQDKAVTNNLESESLEDTRGSGKKMSKGWNTWALA
FT                   LHSIAMHPERHENVVLEYLDNIVVINDQYPKARKHVLVLARQESLDGLEDVRKENLQLL
FT                   QEMHNVGLKWVDRFQNEDASLIFRLGYHSVPSMRQLHLHVISQDFNSDSLKNKKHWNSF
FT                   TTSFFRDSVDVLEEVNSQGKANVASEDLLKGELRCNRCRSAHPNIPKLKSHVRSCHSQF
FT                   PDHLLQNNRLVARAET"
     MEVQIEESGK NQTSPESIEA DKAKQIVVLL IGPPGSGKST FCDTAMRSSH RPWSRICQDI        60
     VNNGKAGTKA QCLKMATDSL REGKSVFIDR CNLDREQRSE FIKLGGPEFE VHAVVLELPA       120
     QVCISRSVKR TGHEGNLQGG RAAAVVNKML QSKELPKVNE GFSRIMFCYS DADVDNAVNM       180
     YNKLGPMDTL PSGCFGEKKL DTKSQPGIMK FFKKVSALPA SSSNEATNTT RKADEMTANV       240
     RVSPVKLGSA DIVPTLAFPS ISTADFQFDL EKASDIIVEK AEEFLSKLGT ARLVLVDLSR       300
     GSKILSLVKA KASQKNIDSA KFFTFVGDIT KLRSEGGLHC NVIANATNWR LKPGGGGVNA       360
     AIFKAAGPDL ETATRVRANT LLPGKAVVVP LPSTCPLHNA EGITHVIHVL GPNMNPNRPD       420
     NLNNDYTKGC KTLREAYTSL FEGFLSVVQD QSKLPKRSSQ TAVSDSGEDI KEDSERNKKY       480
     KGSQDKAVTN NLESESLEDT RGSGKKMSKG WNTWALALHS IAMHPERHEN VVLEYLDNIV       540
     VINDQYPKAR KHVLVLARQE SLDGLEDVRK ENLQLLQEMH NVGLKWVDRF QNEDASLIFR       600
     LGYHSVPSMR QLHLHVISQD FNSDSLKNKK HWNSFTTSFF RDSVDVLEEV NSQGKANVAS       660
     EDLLKGELRC NRCRSAHPNI PKLKSHVRSC HSQFPDHLLQ NNRLVARAET                  710
//

If you have problems or comments...

PBIL Back to PBIL home page