(data stored in ACNUC13479 zone)

EMBL: CP002688.BRCA2B

CP002688.BRCA2B      Location/Qualifiers
FT   CDS             complement(join(235117..235182,235275..235448,
FT                   235552..235756,235846..235908,235982..236124,
FT                   236411..236593,236662..236860,237159..237230,
FT                   237314..237425,237525..237606,237693..237743,
FT                   237843..237924,237999..238184,238257..238379,
FT                   238541..238695,238783..238907,239000..239986,
FT                   240231..240392,240528..240671,240758..240911))
FT                   /codon_start=1
FT                   /gene="BRCA2B"
FT                   /gene_synonym="ATBRCA2(V)"
FT                   /gene_synonym="BRCA2(V)"
FT                   /gene_synonym="BRCA2-like B"
FT                   /gene_synonym="F7A7.150"
FT                   /gene_synonym="F7A7_150"
FT                   /locus_tag="AT5G01630"
FT                   /product="BRCA2-like B"
FT                   /note="BRCA2-like B (BRCA2B); FUNCTIONS IN: single-stranded
FT                   DNA binding; INVOLVED IN: meiosis; LOCATED IN:
FT                   mitochondrion; CONTAINS InterPro DOMAIN/s: Nucleic
FT                   acid-binding, OB-fold-like (InterPro:IPR016027), DNA
FT                   recombination/repair protein BRCA2, helical domain
FT                   (InterPro:IPR015252), DNA recombination and repair protein,
FT                   BRCA2 (InterPro:IPR011370), BRCA2,
FT                   oligonucleotide/oligosaccharide-binding 1
FT                   (InterPro:IPR015187), Breast cancer type 2 susceptibility
FT                   protein (InterPro:IPR015525), BRCA2 repeat
FT                   (InterPro:IPR002093); BEST Arabidopsis thaliana protein
FT                   match is: BREAST CANCER 2 like 2A (TAIR:AT4G00020.1); Has
FT                   281 Blast hits to 210 proteins in 91 species: Archae - 0;
FT                   Bacteria - 4; Metazoa - 134; Fungi - 18; Plants - 61;
FT                   Viruses - 0; Other Eukaryotes - 64 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q7Y1C4"
FT                   /db_xref="InterPro:IPR002093"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015187"
FT                   /db_xref="InterPro:IPR015252"
FT                   /db_xref="InterPro:IPR015525"
FT                   /db_xref="InterPro:IPR036315"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7Y1C4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL083723.1,INSD:EH957220.1,INSD:AU227536.1,
FT                   INSD:DR379270.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AJ488305.1,INSD:BT004117.1"
FT                   /protein_id="AED90369.1"
FT                   /translation="MSTWHLFSDSSGDGFRWEVAGRILQSVSDSTPTKALESTAPLPSM
FT                   ADLLLQGCSKLIEREESMPGEIPMFRTGLGKSVVLKESSIAKAKSILAENVAYSDLQNT
FT                   NCSIPQTRQVDTAETMPMFRTALGKTVPLKESSIAKPLSILGSDMIIDSDNVLPRESGF
FT                   GVPNSLFQTASNKKVNVSSAGLARAKALLGLEEDDLNGFNHVNQSSSSLQQHGWSGLKT
FT                   HEEFDATVVKHHSGTPGQYENYVSGKRSEILNPSLKVPPTKFQTAGGKSLSVSAEALKR
FT                   ARNLLGDPELGSFFDDVAGGDQFFTPQKDERLSDIAINNGSVNTGYIAHEEKTSNKHTS
FT                   NSFVSPLHSSSKQFRSVNLENLASGGNLIKKFDTAVDETNCALNISKPATHGLSNNRPL
FT                   ASDMAVNNSKGNGFIPRARQLGRPADQPLVDITNRRDTAYANNKQDSTQKKRLGKTVSV
FT                   SPFKRPRISSFKTPLKKNAQQASSGLSVVSCDTLTSKKVLSTRYPEKSPRVYIKEFFGM
FT                   HPTATTRMDYVPDHVRRIKSSNADKYVFCDESSSNKVGAETFLQMLAESGASLQHASRK
FT                   WVTNHYRWIVWKLACYDIYYPAKCRGNFLTITNVLEELKYRYEREVNHGHCSAIKRILS
FT                   GDAPASSMMVLCISAINPRTDNGSQEAHCSDNCSNVKVELTDGWYSMNAALDVVLTKQL
FT                   NAGKLFVGQKLRILGAGLSGWATPTSPLEAVISSTICLLLNINGTYRAHWADRLGFCKE
FT                   IGVPLAFNCIKCNGGPVPKTLAGITRIYPILYKERLGEKKSIVRSERIESRIIQLHNQR
FT                   RSALVEGIMCEYQRGINGVHSQNDTDSEEGAKVFKLLETAAEPELLMAEMSLEQLTSFT
FT                   TYKAKFEAAKQMQMEKSVAKALEDAGLGERNVTPFMRIRLVGLTSLSNEGEHNPKEGIV
FT                   TIWDPTERQRTELTEGKIYIMKGLVPMNSDSETLYLHARGSSSRWQPLSPKDSENFQPF
FT                   FNPRKPISLSNLGEIPLSSEFDIAAYVVYVGDAYTDVLQKKQWVFVTDGSTQHSGEISN
FT                   SLLAISFSTPFMDDSSVSHISHNLVGSVVGFCNLIKRAKDATNEMWVAETTENSVYFIN
FT                   AEAAYSSHLKTRSAHIQTWAKLYSSKSVIHELRQRVLFIIGACKSPSC"
     MSTWHLFSDS SGDGFRWEVA GRILQSVSDS TPTKALESTA PLPSMADLLL QGCSKLIERE        60
     ESMPGEIPMF RTGLGKSVVL KESSIAKAKS ILAENVAYSD LQNTNCSIPQ TRQVDTAETM       120
     PMFRTALGKT VPLKESSIAK PLSILGSDMI IDSDNVLPRE SGFGVPNSLF QTASNKKVNV       180
     SSAGLARAKA LLGLEEDDLN GFNHVNQSSS SLQQHGWSGL KTHEEFDATV VKHHSGTPGQ       240
     YENYVSGKRS EILNPSLKVP PTKFQTAGGK SLSVSAEALK RARNLLGDPE LGSFFDDVAG       300
     GDQFFTPQKD ERLSDIAINN GSVNTGYIAH EEKTSNKHTS NSFVSPLHSS SKQFRSVNLE       360
     NLASGGNLIK KFDTAVDETN CALNISKPAT HGLSNNRPLA SDMAVNNSKG NGFIPRARQL       420
     GRPADQPLVD ITNRRDTAYA NNKQDSTQKK RLGKTVSVSP FKRPRISSFK TPLKKNAQQA       480
     SSGLSVVSCD TLTSKKVLST RYPEKSPRVY IKEFFGMHPT ATTRMDYVPD HVRRIKSSNA       540
     DKYVFCDESS SNKVGAETFL QMLAESGASL QHASRKWVTN HYRWIVWKLA CYDIYYPAKC       600
     RGNFLTITNV LEELKYRYER EVNHGHCSAI KRILSGDAPA SSMMVLCISA INPRTDNGSQ       660
     EAHCSDNCSN VKVELTDGWY SMNAALDVVL TKQLNAGKLF VGQKLRILGA GLSGWATPTS       720
     PLEAVISSTI CLLLNINGTY RAHWADRLGF CKEIGVPLAF NCIKCNGGPV PKTLAGITRI       780
     YPILYKERLG EKKSIVRSER IESRIIQLHN QRRSALVEGI MCEYQRGING VHSQNDTDSE       840
     EGAKVFKLLE TAAEPELLMA EMSLEQLTSF TTYKAKFEAA KQMQMEKSVA KALEDAGLGE       900
     RNVTPFMRIR LVGLTSLSNE GEHNPKEGIV TIWDPTERQR TELTEGKIYI MKGLVPMNSD       960
     SETLYLHARG SSSRWQPLSP KDSENFQPFF NPRKPISLSN LGEIPLSSEF DIAAYVVYVG      1020
     DAYTDVLQKK QWVFVTDGST QHSGEISNSL LAISFSTPFM DDSSVSHISH NLVGSVVGFC      1080
     NLIKRAKDAT NEMWVAETTE NSVYFINAEA AYSSHLKTRS AHIQTWAKLY SSKSVIHELR      1140
     QRVLFIIGAC KSPSC                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page