(data stored in ACNUC13479 zone)

EMBL: CP002688.BSK10

CP002688.BSK10       Location/Qualifiers
FT   CDS             join(22740..23054,23136..23271,23359..23492,23580..23771,
FT                   23858..24079,24181..24336,24412..24525,24617..24847)
FT                   /codon_start=1
FT                   /gene="BSK10"
FT                   /gene_synonym="F7J8.40"
FT                   /gene_synonym="F7J8_40"
FT                   /gene_synonym="brassinosteroid-signaling kinase 10"
FT                   /locus_tag="AT5G01060"
FT                   /product="kinase with tetratricopeptide repeat
FT                   domain-containing protein"
FT                   /note="Protein kinase protein with tetratricopeptide repeat
FT                   domain; FUNCTIONS IN: binding, protein kinase activity,
FT                   kinase activity, ATP binding; INVOLVED IN: protein amino
FT                   acid phosphorylation, N-terminal protein myristoylation;
FT                   LOCATED IN: cellular_component unknown; EXPRESSED IN:
FT                   petal, cotyledon, root; EXPRESSED DURING: petal
FT                   differentiation and expansion stage; CONTAINS InterPro
FT                   DOMAIN/s: Tetratricopeptide-like helical
FT                   (InterPro:IPR011990), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Serine-threonine/tyrosine-protein
FT                   kinase (InterPro:IPR001245), Protein kinase-like domain
FT                   (InterPro:IPR011009); BEST Arabidopsis thaliana protein
FT                   match is: Protein kinase protein with tetratricopeptide
FT                   repeat domain (TAIR:AT3G09240.1); Has 1807 Blast hits to
FT                   1807 proteins in 277 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0;
FT                   Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LFD0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFD0"
FT                   /protein_id="AED90293.1"
FT                   /translation="MGCICFKSWRRSSSSPSITSTVIDDLENVREYDADDDGGHYPLIF
FT                   REFSLEQLRIATDGFSAGNIVSEHNDSVPNIVYKGKLGDGRRIAVKRFQRLSWPDPFEF
FT                   INEAQAVGRLRSEHMANLIGCCCDDNERLLVAEYMPNGTLAKHLFHWEKRPMKWEMRLK
FT                   VALHTARALEYCNDKGIDLYHDLNPYRIMFDKTGIPKLSCFGLMKNSHEGKIYSTNLAF
FT                   APPEYLRLGTVIAESVTFSFGTLLLDLMSGRHIPPNHALDLFRGKNYLVLMDSALDGQF
FT                   SDEDRTELIHVASRCFKTEPEERPSIKFLKATLSRLQKRAKLCPINVKRPMSPPSKNLP
FT                   EKTKPATESLKLTPFGDACSRADLSSIHELLEKLGYEEDNGVGNEFSFQMWTGEMQENM
FT                   DYKKHGDAAFLAKDFDTAIEFYTEFMTGAPTVSPTVLARRCLCYLMTEMFSEALSDAMQ
FT                   AQVASPEWPIPLYLQAACLFKLEMEAEAKEALRHGSALEAY"
     MGCICFKSWR RSSSSPSITS TVIDDLENVR EYDADDDGGH YPLIFREFSL EQLRIATDGF        60
     SAGNIVSEHN DSVPNIVYKG KLGDGRRIAV KRFQRLSWPD PFEFINEAQA VGRLRSEHMA       120
     NLIGCCCDDN ERLLVAEYMP NGTLAKHLFH WEKRPMKWEM RLKVALHTAR ALEYCNDKGI       180
     DLYHDLNPYR IMFDKTGIPK LSCFGLMKNS HEGKIYSTNL AFAPPEYLRL GTVIAESVTF       240
     SFGTLLLDLM SGRHIPPNHA LDLFRGKNYL VLMDSALDGQ FSDEDRTELI HVASRCFKTE       300
     PEERPSIKFL KATLSRLQKR AKLCPINVKR PMSPPSKNLP EKTKPATESL KLTPFGDACS       360
     RADLSSIHEL LEKLGYEEDN GVGNEFSFQM WTGEMQENMD YKKHGDAAFL AKDFDTAIEF       420
     YTEFMTGAPT VSPTVLARRC LCYLMTEMFS EALSDAMQAQ VASPEWPIPL YLQAACLFKL       480
     EMEAEAKEAL RHGSALEAY                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page