(data stored in ACNUC13479 zone)

EMBL: CP002688.CAX4

CP002688.CAX4        Location/Qualifiers
FT   CDS             join(195589..195876,195984..196051,196160..196188,
FT                   196453..196649,196782..197003,197099..197239,
FT                   197328..197444,197543..197596,197823..197939,
FT                   198024..198114,198204..198240,198462..198465)
FT                   /codon_start=1
FT                   /gene="CAX4"
FT                   /gene_synonym="ATCAX4"
FT                   /gene_synonym="cation exchanger 4"
FT                   /gene_synonym="F7A7.10"
FT                   /gene_synonym="F7A7_10"
FT                   /locus_tag="AT5G01490"
FT                   /product="cation exchanger 4"
FT                   /note="cation exchanger 4 (CAX4); CONTAINS InterPro
FT                   DOMAIN/s: Sodium/calcium exchanger membrane region
FT                   (InterPro:IPR004837), Calcium/proton exchanger superfamily
FT                   (InterPro:IPR004798), Calcium/proton exchanger
FT                   (InterPro:IPR004713); BEST Arabidopsis thaliana protein
FT                   match is: cation exchanger 1 (TAIR:AT2G38170.3); Has 3152
FT                   Blast hits to 2978 proteins in 994 species: Archae - 25;
FT                   Bacteria - 1749; Metazoa - 60; Fungi - 737; Plants - 238;
FT                   Viruses - 0; Other Eukaryotes - 343 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q945S5"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q945S5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV547983.1,INSD:DR369119.1,INSD:EL045687.1"
FT                   /protein_id="AED90352.1"
FT                   /translation="MSSISTESSSNLSLLENGGGGSDKPTAETSRRVRRTVSASSLIRK
FT                   RSDLKLISRVRWEFMRRILTNLQEVLLGTKLFILFPAVPLAVVAHRYDCPRAWVFALSL
FT                   LGLTPLAERISFLTEQIAFHTGPTVGGLMNATCGNATEMIIAILAVGQRKMRIVKLSLL
FT                   GSILSNLLFVLGTSLFLGGISNLRKHQSFDPRQGDMNSMLLYLALLCQTLPMIMRFTME
FT                   AEEYDGSDVVVLSRASSFVMLIAYLAFLIFHLFSSHLSPPPPPLPQREDVHDDDVSDKE
FT                   EEGAVIGMWSAIFWLIIMTLLVALLSDYLVSTIQDAADSWGLSVGFIGIILLPIVGNAA
FT                   EHAGAVIFAFRNKLDITLGIALGSATQIALFVVPVTVLVAWTMGIEMDLNFNLLETACF
FT                   ALSILVTSLVLQDGTSNYMKGLVLLLCYVVIAACFFVSNSPSTETNTTNHTITKR"
     MSSISTESSS NLSLLENGGG GSDKPTAETS RRVRRTVSAS SLIRKRSDLK LISRVRWEFM        60
     RRILTNLQEV LLGTKLFILF PAVPLAVVAH RYDCPRAWVF ALSLLGLTPL AERISFLTEQ       120
     IAFHTGPTVG GLMNATCGNA TEMIIAILAV GQRKMRIVKL SLLGSILSNL LFVLGTSLFL       180
     GGISNLRKHQ SFDPRQGDMN SMLLYLALLC QTLPMIMRFT MEAEEYDGSD VVVLSRASSF       240
     VMLIAYLAFL IFHLFSSHLS PPPPPLPQRE DVHDDDVSDK EEEGAVIGMW SAIFWLIIMT       300
     LLVALLSDYL VSTIQDAADS WGLSVGFIGI ILLPIVGNAA EHAGAVIFAF RNKLDITLGI       360
     ALGSATQIAL FVVPVTVLVA WTMGIEMDLN FNLLETACFA LSILVTSLVL QDGTSNYMKG       420
     LVLLLCYVVI AACFFVSNSP STETNTTNHT ITKR                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page