(data stored in ACNUC13479 zone)

EMBL: CP002688.CHX26

CP002688.CHX26       Location/Qualifiers
FT   CDS             complement(join(253996..254238,254315..255202,
FT                   255287..256297,256428..256640))
FT                   /codon_start=1
FT                   /gene="CHX26"
FT                   /gene_synonym="ARABIDOPSIS THALIANA CATION/HYDROGEN
FT                   EXCHANGER 26"
FT                   /gene_synonym="ATCHX26"
FT                   /gene_synonym="cation/H+ exchanger 26"
FT                   /gene_synonym="F7A7.200"
FT                   /gene_synonym="F7A7_200"
FT                   /locus_tag="AT5G01680"
FT                   /product="cation/H+ exchanger 26"
FT                   /note="cation/H+ exchanger 26 (CHX26); FUNCTIONS IN:
FT                   monovalent cation:hydrogen antiporter activity,
FT                   sodium:hydrogen antiporter activity; INVOLVED IN: cation
FT                   transport; LOCATED IN: integral to membrane; EXPRESSED IN:
FT                   male gametophyte, leaf, pollen tube; CONTAINS InterPro
FT                   DOMAIN/s: Cation/H+ exchanger (InterPro:IPR006153); BEST
FT                   Arabidopsis thaliana protein match is: cation/H+ exchanger
FT                   27 (TAIR:AT5G01690.1); Has 1807 Blast hits to 1807 proteins
FT                   in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736;
FT                   Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes -
FT                   339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M008"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M008"
FT                   /protein_id="AED90376.1"
FT                   /translation="MNNSVTSNGTHEFVCEAWLGSSSGGLLRGDDPLKYSTPLLLLLIS
FT                   LVSSLSSVFQALLRPLANVDFVTQILAGIFLGPSALGQNIDLVKKLFNTRSYFIIESFE
FT                   AISFMFISYISTAQVDMGVIKRGGKLAIINGLSLFLFPYVVGAIACTVITSNIRGTVAK
FT                   NNPEQLHNLLTNQSVVYFQVAYSVLSNLKMLNSEPGRLALSSIMVANCFGWGFFLLLIT
FT                   FDSFLHQNYSKTTYLPTFTKVLLLVGIVVVCRPIFNWIVKRTPEGKKLKASHLCTICVM
FT                   LCTATFLSETVGFPYVVGSVALGLVTPKTPPFGTGLTDKIGSFCYAVLMPCYVIGIGNK
FT                   VDFFSFNLRDIISLEFLIFTISAAKFASIVLPSLYFQVPISHAVIVGFIVCIQGIYDVQ
FT                   IFKQLLNYKNISHEAFGIMVISAMVHSTIFTAIVKNLYGWVQRKHITYRRQTVQHYEPN
FT                   KPLKILTCFYHRETVPPILTVLELSTCPSSASSHSIVSVNLEELEQNNVPLLIQHHPGH
FT                   NDESSTSSSRRDQISKAFEKFRSGHDLQENVSVECFTAVAPSKTMHEDVCALAFEKETD
FT                   LIIFGMADGTAAERRLCRNVRNASPSSVAVLMDQGRLPDFKNMGTAMKNGSMRINICSI
FT                   FLGGADDRETLAFAVRMTNQPYVNLTVLKLVDGENVSHLNDVVEKRLDFRTIEKFRQDT
FT                   MNKHNVALREVWIKEASDLVNLLREEGNNYDLIMVGIRHEKSFEVLQGLSVWSEIEELG
FT                   EIGDLLVSRDLKLSASVLAVQQQLSSVVEEV"
     MNNSVTSNGT HEFVCEAWLG SSSGGLLRGD DPLKYSTPLL LLLISLVSSL SSVFQALLRP        60
     LANVDFVTQI LAGIFLGPSA LGQNIDLVKK LFNTRSYFII ESFEAISFMF ISYISTAQVD       120
     MGVIKRGGKL AIINGLSLFL FPYVVGAIAC TVITSNIRGT VAKNNPEQLH NLLTNQSVVY       180
     FQVAYSVLSN LKMLNSEPGR LALSSIMVAN CFGWGFFLLL ITFDSFLHQN YSKTTYLPTF       240
     TKVLLLVGIV VVCRPIFNWI VKRTPEGKKL KASHLCTICV MLCTATFLSE TVGFPYVVGS       300
     VALGLVTPKT PPFGTGLTDK IGSFCYAVLM PCYVIGIGNK VDFFSFNLRD IISLEFLIFT       360
     ISAAKFASIV LPSLYFQVPI SHAVIVGFIV CIQGIYDVQI FKQLLNYKNI SHEAFGIMVI       420
     SAMVHSTIFT AIVKNLYGWV QRKHITYRRQ TVQHYEPNKP LKILTCFYHR ETVPPILTVL       480
     ELSTCPSSAS SHSIVSVNLE ELEQNNVPLL IQHHPGHNDE SSTSSSRRDQ ISKAFEKFRS       540
     GHDLQENVSV ECFTAVAPSK TMHEDVCALA FEKETDLIIF GMADGTAAER RLCRNVRNAS       600
     PSSVAVLMDQ GRLPDFKNMG TAMKNGSMRI NICSIFLGGA DDRETLAFAV RMTNQPYVNL       660
     TVLKLVDGEN VSHLNDVVEK RLDFRTIEKF RQDTMNKHNV ALREVWIKEA SDLVNLLREE       720
     GNNYDLIMVG IRHEKSFEVL QGLSVWSEIE ELGEIGDLLV SRDLKLSASV LAVQQQLSSV       780
     VEEV                                                                    784
//

If you have problems or comments...

PBIL Back to PBIL home page