(data stored in ACNUC13479 zone)

EMBL: CP002688.CHX27

CP002688.CHX27       Location/Qualifiers
FT   CDS             join(257410..257628,257769..258281,258516..259013,
FT                   259096..259953,260130..260345)
FT                   /codon_start=1
FT                   /gene="CHX27"
FT                   /gene_synonym="ARABIDOPSIS THALIANA CATION/HYDROGEN
FT                   EXCHANGER 27"
FT                   /gene_synonym="ATCHX27"
FT                   /gene_synonym="cation/H+ exchanger 27"
FT                   /gene_synonym="F7A7.210"
FT                   /gene_synonym="F7A7_210"
FT                   /locus_tag="AT5G01690"
FT                   /product="cation/H+ exchanger 27"
FT                   /note="cation/H+ exchanger 27 (CHX27); BEST Arabidopsis
FT                   thaliana protein match is: cation/H+ exchanger 26
FT                   (TAIR:AT5G01680.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01690"
FT                   /db_xref="GOA:Q9M007"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M007"
FT                   /protein_id="AED90377.2"
FT                   /translation="MENITKTFQYGGVDWLCEPWVGAGSLGIGRGENPLKFALPLLLLQ
FT                   ISVFSIFSVSFQFLLRPFGKFAFLTQMLAGICLGPSVIGRNKQYMATFFYARSVYIIES
FT                   FEAICFLFICYITTCQVDTRMIKRVGKLAFINGILLFLIPFVWGQFAAILISKRLKSGP
FT                   AGIPPVEFHHVAIVQSTMFFQVVYGVLSSLKMLNTEPGRLALASMMVHDCLSWCFFMLN
FT                   IAIKLNVDLPNKNRAAFLSVLQMIMILVIAYVFRPLMLWMKNRTPEGHSLKASYLSVIC
FT                   VLLFISCLWAEFVGLPYFFGAVVLGLATPKRPPLGTGLSDKIGCFVWSVLMPCYVIGIG
FT                   LNIDLSLFSWRDVIRFELLFGVVRFAKMIAIALPSLYYKVPLWHAILVGFIVNIQGLYD
FT                   VQIYKQNFNYTKISSKSFGAMVMSATVNSTIFIVIVKKLYQTMSKRNPYKRRTVQHCRV
FT                   EAPLRILTCFRNREAVRPVLDLVELSRPAIGSPLSVFAVNLEELNNHSLPLLIHHTQEI
FT                   SPFLVPSRRDQIVKAFHNFEKTNQETVLIECFTAVAPRKTMHEDVCAIAFDQETDIVIL
FT                   TLDAGIELWERLLCRNLLHNCPCSVALFIDRGRLPDFRFVPLKKLTINIGAIFLGGPDD
FT                   REMLAYATRLASHPSVELQVFRLVDQNGVSPLRDMVERNHDMRVINVFRKENSEKNIIF
FT                   REVRIEEAVNLLDLLRKEGDDFDLMMVGIRHEENLLMLEGLSEWSDMKELGEVGDVLIS
FT                   KDLELSVSVLAVQQ"
     MENITKTFQY GGVDWLCEPW VGAGSLGIGR GENPLKFALP LLLLQISVFS IFSVSFQFLL        60
     RPFGKFAFLT QMLAGICLGP SVIGRNKQYM ATFFYARSVY IIESFEAICF LFICYITTCQ       120
     VDTRMIKRVG KLAFINGILL FLIPFVWGQF AAILISKRLK SGPAGIPPVE FHHVAIVQST       180
     MFFQVVYGVL SSLKMLNTEP GRLALASMMV HDCLSWCFFM LNIAIKLNVD LPNKNRAAFL       240
     SVLQMIMILV IAYVFRPLML WMKNRTPEGH SLKASYLSVI CVLLFISCLW AEFVGLPYFF       300
     GAVVLGLATP KRPPLGTGLS DKIGCFVWSV LMPCYVIGIG LNIDLSLFSW RDVIRFELLF       360
     GVVRFAKMIA IALPSLYYKV PLWHAILVGF IVNIQGLYDV QIYKQNFNYT KISSKSFGAM       420
     VMSATVNSTI FIVIVKKLYQ TMSKRNPYKR RTVQHCRVEA PLRILTCFRN REAVRPVLDL       480
     VELSRPAIGS PLSVFAVNLE ELNNHSLPLL IHHTQEISPF LVPSRRDQIV KAFHNFEKTN       540
     QETVLIECFT AVAPRKTMHE DVCAIAFDQE TDIVILTLDA GIELWERLLC RNLLHNCPCS       600
     VALFIDRGRL PDFRFVPLKK LTINIGAIFL GGPDDREMLA YATRLASHPS VELQVFRLVD       660
     QNGVSPLRDM VERNHDMRVI NVFRKENSEK NIIFREVRIE EAVNLLDLLR KEGDDFDLMM       720
     VGIRHEENLL MLEGLSEWSD MKELGEVGDV LISKDLELSV SVLAVQQ                     767
//

If you have problems or comments...

PBIL Back to PBIL home page