(data stored in ACNUC13479 zone)

EMBL: CP002688.CIPK15

CP002688.CIPK15      Location/Qualifiers
FT   CDS             310460..311725
FT                   /codon_start=1
FT                   /gene="CIPK15"
FT                   /gene_synonym="ATPK10"
FT                   /gene_synonym="CBL-interacting protein kinase 15"
FT                   /gene_synonym="PKS3"
FT                   /gene_synonym="PROTEIN KINASE 10"
FT                   /gene_synonym="SERINE/THREONINE PROTEIN KINASE 10"
FT                   /gene_synonym="SIP2"
FT                   /gene_synonym="SMALL AND BASIC INTRINSIC PROTEIN 2"
FT                   /gene_synonym="SNF1-RELATED PROTEIN KINASE 3.1"
FT                   /gene_synonym="SNRK3.1"
FT                   /gene_synonym="SOS3-INTERACTING PROTEIN 2"
FT                   /gene_synonym="T20L15.80"
FT                   /gene_synonym="T20L15_80"
FT                   /locus_tag="AT5G01810"
FT                   /product="CBL-interacting protein kinase 15"
FT                   /note="CBL-interacting protein kinase 15 (CIPK15); CONTAINS
FT                   InterPro DOMAIN/s: Protein kinase, ATP binding site
FT                   (InterPro:IPR017441), Serine/threonine-protein kinase
FT                   domain (InterPro:IPR002290), NAF/FISL domain
FT                   (InterPro:IPR018451), Serine/threonine-protein kinase-like
FT                   domain (InterPro:IPR017442), Protein kinase-like domain
FT                   (InterPro:IPR011009), Serine/threonine-protein kinase,
FT                   active site (InterPro:IPR008271), NAF domain
FT                   (InterPro:IPR004041), CBL-interacting protein kinase
FT                   (InterPro:IPR020660), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Calcium/calmodulin-dependent protein
FT                   kinase-like (InterPro:IPR020636); BEST Arabidopsis thaliana
FT                   protein match is: SOS3-interacting protein 1
FT                   (TAIR:AT5G58380.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:P92937"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004041"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018451"
FT                   /db_xref="UniProtKB/Swiss-Prot:P92937"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES018919.1,INSD:DR379310.1,INSD:AU237397.1,
FT                   INSD:AV525606.1,INSD:AA605419.1,INSD:BP654359.1,
FT                   INSD:BP810542.1,INSD:T13762.1,INSD:EL218677.1,
FT                   INSD:EL024734.1,INSD:EL230005.1,INSD:BP828286.1,
FT                   INSD:ES108963.1,INSD:AU228447.1,INSD:AV539575.1,
FT                   INSD:BP646999.1,INSD:BP834356.1,INSD:EH984511.1,
FT                   INSD:EL232861.1,INSD:BP802304.1,INSD:EL024470.1,
FT                   INSD:EL060892.1,INSD:ES165951.1,INSD:EL158213.1,
FT                   INSD:EH831676.1,INSD:BP855286.1,INSD:BP651430.1,
FT                   INSD:EL235817.1,INSD:R90018.1,INSD:DR261305.1,
FT                   INSD:ES203344.1,INSD:EH983318.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT028964.1,INSD:AK228889.1,INSD:AF339144.1,
FT                   INSD:D30622.1,INSD:AF302111.1"
FT                   /protein_id="AED90394.1"
FT                   /translation="MEKKGSVLMLRYEVGKFLGQGTFAKVYHARHLKTGDSVAIKVIDK
FT                   ERILKVGMTEQIKREISAMRLLRHPNIVELHEVMATKSKIYFVMEHVKGGELFNKVSTG
FT                   KLREDVARKYFQQLVRAVDFCHSRGVCHRDLKPENLLLDEHGNLKISDFGLSALSDSRR
FT                   QDGLLHTTCGTPAYVAPEVISRNGYDGFKADVWSCGVILFVLLAGYLPFRDSNLMELYK
FT                   KIGKAEVKFPNWLAPGAKRLLKRILDPNPNTRVSTEKIMKSSWFRKGLQEEVKESVEEE
FT                   TEVDAEAEGNASAEKEKKRCINLNAFEIISLSTGFDLSGLFEKGEEKEEMRFTSNREAS
FT                   EITEKLVEIGKDLKMKVRKKEHEWRVKMSAEATVVEAEVFEIAPSYHMVVLKKSGGDTA
FT                   EYKRVMKESIRPALIDFVLAWH"
     MEKKGSVLML RYEVGKFLGQ GTFAKVYHAR HLKTGDSVAI KVIDKERILK VGMTEQIKRE        60
     ISAMRLLRHP NIVELHEVMA TKSKIYFVME HVKGGELFNK VSTGKLREDV ARKYFQQLVR       120
     AVDFCHSRGV CHRDLKPENL LLDEHGNLKI SDFGLSALSD SRRQDGLLHT TCGTPAYVAP       180
     EVISRNGYDG FKADVWSCGV ILFVLLAGYL PFRDSNLMEL YKKIGKAEVK FPNWLAPGAK       240
     RLLKRILDPN PNTRVSTEKI MKSSWFRKGL QEEVKESVEE ETEVDAEAEG NASAEKEKKR       300
     CINLNAFEII SLSTGFDLSG LFEKGEEKEE MRFTSNREAS EITEKLVEIG KDLKMKVRKK       360
     EHEWRVKMSA EATVVEAEVF EIAPSYHMVV LKKSGGDTAE YKRVMKESIR PALIDFVLAW       420
     H                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page