(data stored in ACNUC13479 zone)

EMBL: CP002688.CPL2

CP002688.CPL2        Location/Qualifiers
FT   CDS             complement(join(107943..107958,108167..108311,
FT                   108451..108547,108636..108689,108768..108901,
FT                   109159..109210,109285..109595,109705..109837,
FT                   109954..110046,110133..110238,110330..110400,
FT                   110497..110654,110932..111142,111308..111778,
FT                   111871..112143))
FT                   /codon_start=1
FT                   /gene="CPL2"
FT                   /gene_synonym="ATCPL2"
FT                   /gene_synonym="carboxyl-terminal domain (ctd)
FT                   phosphatase-like 2"
FT                   /gene_synonym="F7J8.250"
FT                   /gene_synonym="F7J8_250"
FT                   /locus_tag="AT5G01270"
FT                   /product="carboxyl-terminal domain (ctd) phosphatase-like
FT                   2"
FT                   /note="carboxyl-terminal domain (ctd) phosphatase-like 2
FT                   (CPL2); FUNCTIONS IN: double-stranded RNA binding,
FT                   phosphatase activity; INVOLVED IN: response to auxin
FT                   stimulus, response to osmotic stress, developmental growth;
FT                   LOCATED IN: intracellular; EXPRESSED IN: 25 plant
FT                   structures; EXPRESSED DURING: 14 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Double-stranded RNA-binding
FT                   (InterPro:IPR001159), Double-stranded RNA-binding-like
FT                   (InterPro:IPR014720), NLI interacting factor
FT                   (InterPro:IPR004274); BEST Arabidopsis thaliana protein
FT                   match is: C-terminal domain phosphatase-like 1
FT                   (TAIR:AT4G21670.1)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01270"
FT                   /db_xref="GOA:F4K802"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR039189"
FT                   /db_xref="UniProtKB/TrEMBL:F4K802"
FT                   /protein_id="AED90321.1"
FT                   /translation="MNRLGHKSVVYHGDLRLGELDVNHVSSSHEFRFPNDEIRIHHLSP
FT                   AGERCPPLAILQTIASFAVRCKLESSAPVKSQELMHLHAVCFHELKTAVVMLGDEEIHL
FT                   VAMPSKEKKFPCFWCFSVPSGLYDSCLRMLNTRCLSIVFDLDETLIVANTMKSFEDRIE
FT                   ALKSWISREMDPVRINGMSAELKRYMDDRMLLKQYIDNDYAFDNGVLLKAQPEEVRPTS
FT                   DGQEKVCRPVIRLPEKNTVLTRIKPEIRDTSVLVKLRPAWEELRSYLTAKTRKRFEVYV
FT                   CTMAERDYALEMWRLLDPEAHLISLKELRDRIVCVKPDAKKSLLSVFNGGICHPKMAMV
FT                   IDDRMKVWEDKDQPRVHVVSAYLPYYAPQAETALVVPHLCVARNVACNVRGYFFKEFDE
FT                   SLMSSISLVYYEDDVENLPPSPDVSNYVVIEDPGFASNGNINAPPINEGMCGGEVERRL
FT                   NQAAAADHSTLPATSNAEQKPETPKPQIAVIPNNASTATAAALLPSHKPSLLGAPRRDG
FT                   FTFSDGGRPLMMRPGVDIRNQNFNQPPILAKIPMQPPSSSMHSPGGWLVDDENRPSFPG
FT                   RPSGLYPSQFPHGTPGSAPVGPFAHPSHLRSEEVAMDDDLKRQNPSRQTTEGGISQNHL
FT                   VSNGREHHTDGGKSNGGQSHLFVSALQEIGRRCGSKVEFRTVISTNKELQFSVEVLFTG
FT                   EKIGIGMAKTKKDAHQQAAENALRSLAEKYVAHVAPLARETEKGPENDNGFLWESSEDV
FT                   SNKGLEEEAPKENISELVLRK"
     MNRLGHKSVV YHGDLRLGEL DVNHVSSSHE FRFPNDEIRI HHLSPAGERC PPLAILQTIA        60
     SFAVRCKLES SAPVKSQELM HLHAVCFHEL KTAVVMLGDE EIHLVAMPSK EKKFPCFWCF       120
     SVPSGLYDSC LRMLNTRCLS IVFDLDETLI VANTMKSFED RIEALKSWIS REMDPVRING       180
     MSAELKRYMD DRMLLKQYID NDYAFDNGVL LKAQPEEVRP TSDGQEKVCR PVIRLPEKNT       240
     VLTRIKPEIR DTSVLVKLRP AWEELRSYLT AKTRKRFEVY VCTMAERDYA LEMWRLLDPE       300
     AHLISLKELR DRIVCVKPDA KKSLLSVFNG GICHPKMAMV IDDRMKVWED KDQPRVHVVS       360
     AYLPYYAPQA ETALVVPHLC VARNVACNVR GYFFKEFDES LMSSISLVYY EDDVENLPPS       420
     PDVSNYVVIE DPGFASNGNI NAPPINEGMC GGEVERRLNQ AAAADHSTLP ATSNAEQKPE       480
     TPKPQIAVIP NNASTATAAA LLPSHKPSLL GAPRRDGFTF SDGGRPLMMR PGVDIRNQNF       540
     NQPPILAKIP MQPPSSSMHS PGGWLVDDEN RPSFPGRPSG LYPSQFPHGT PGSAPVGPFA       600
     HPSHLRSEEV AMDDDLKRQN PSRQTTEGGI SQNHLVSNGR EHHTDGGKSN GGQSHLFVSA       660
     LQEIGRRCGS KVEFRTVIST NKELQFSVEV LFTGEKIGIG MAKTKKDAHQ QAAENALRSL       720
     AEKYVAHVAP LARETEKGPE NDNGFLWESS EDVSNKGLEE EAPKENISEL VLRK             774
//

If you have problems or comments...

PBIL Back to PBIL home page