(data stored in ACNUC13479 zone)

EMBL: CP002688.ESP4

CP002688.ESP4        Location/Qualifiers
FT   CDS             complement(join(162803..163505,163615..163718,
FT                   163809..163892,163996..164040,164121..164192,
FT                   164295..164375,164517..164612,164685..164759,
FT                   164845..164892,164996..165079,165167..165274,
FT                   165352..165414,165520..165669,165790..165888,
FT                   165970..166017,166265..166507,166582..166698,
FT                   166988..167056,167391..167936,168051..168605,
FT                   168711..168836,169035..169206,169645..169813,
FT                   169924..169999,170082..170174,170284..170443,
FT                   170870..171084))
FT                   /codon_start=1
FT                   /gene="ESP4"
FT                   /gene_synonym="ENHANCED SILENCING PHENOTYPE 4"
FT                   /gene_synonym="T10O8.110"
FT                   /gene_synonym="T10O8_110"
FT                   /locus_tag="AT5G01400"
FT                   /product="HEAT repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01400"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022075"
FT                   /db_xref="InterPro:IPR032460"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B9H4"
FT                   /protein_id="ANM68245.1"
FT                   /translation="MVGIMASYSRARLKDLANSAKSATELPPKLQRLRYMRRDLQKDDS
FT                   VFPTELLPHLFDLLSDQFGAVRKFVAEILGEIGLKYVELIPEIVPLLIKSLEDETPAVA
FT                   RQVIACGADLFRSTLERVAVQGLHSSELNDLLESSWTWLIKFKDEICSVAFKQGNSGVK
FT                   LCAMKFVEALILLYTPHEGIEADFNISILRGGHPVLKIGDLSIEASQKLGLLLDQLRHP
FT                   AAKSLNSSTIIVLINSLSSVAKKRPAYCGRILPVLLSLDPLSFLKGVYAAATNLALKTV
FT                   FLSCLKCTHPAAAPWKDRLTSALKEIEGGGQAAKAKDLFYKTNGSIQDKDSVEDTKVSV
FT                   EENPLCASSDVAESNLSRKRSGSEYNIDLNGDASDGKRARITPSVSEESTDGLNGNDGV
FT                   SLPRVASTSTGPSDSRGVSDSGPAQQLVGLFGTLVSQGEKAIGSLEILISSISADLLTD
FT                   VVMANMHNIPPNCSSYADGTDELVMNMCIVGSDAQIKYPPSFVAGVLSLSTAFPPIAAL
FT                   INPHNEDEEVYSVHVDQQMFPAEDARTPPGLLATCDTSFPENEESNTVSPQNVHYIGNR
FT                   ESGIPGLESSAQHDGSGALVTNVLSSTNVEAASKNQNASFSGKLLVDVIPSMSVDKLEE
FT                   FSPKAVGTVASASQFVLPKISAPVVDLSDEEKDSLQKLVFLRIVEAYKQISMSGGSQLR
FT                   FSLLAHLGVEFPSELDPWKILQEHVLSDYLNHEGHELTVRVLYRLYGEAEAEQDFFSST
FT                   TAASAYESFLLTVAEALRDSFPPSDKSLSKLLGDSPHLPKSVLMLLESFCCPGSGEVEK
FT                   DLQHGDRVTQGLSAVWSLILMRPGIRNDCLNIALQSAVHHLEEIRMKAIRLVANKLYSL
FT                   SFITEQIEEFAKDRLFSVVSDDCDKMDLDLKSPPNKPQHSISGMSMETPSEATSSSTSV
FT                   TEAQRCLSLYFALCTKKHSLFVHVFSIYKNASDPVKQAIHLQIPILVRTMGSSSELLKI
FT                   IADPPSGSDNLLIQVLQTLTEGPTPSSELILTIRKLFDTRIKDVEILFPILPFLPRDDV
FT                   LRIFPHMVNLPMEKFQVALSRVLQGSSQSGPVLSPSEALIAIHSIDPARDGIPLKQVTD
FT                   ACNTCFAQRQTFTQQVLAGVLNQLVQQIPLPMLFMRTVLQAIGAFPALSDFILEILSRL
FT                   VSKQIWKYPKLWVGFLKCTQTTQPQSYKVLLQLPPLQLGNALTKIPALRAPLTAHASQP
FT                   EIQSSLPRSTLAVLGLVPDSQGTQTSQVQANETQTSQEQQQQQASEPQQTSQSQQVSVP
FT                   LSHSQVDHQEPSQVVASQSQSSPIGTVQSAMSQSQNSPIDTGRSEMSQSQNSPIDTGRS
FT                   EMSQSQNSPIDTGRSEMSQSQNSPIDTGRSEMSESQSSPIGQSQSSPIGTGQSDMSQTP
FT                   QVSDSSAPEPTSHTRTSDPQASSQTLRDDDEKIDDTATSENEVTEIEKSKESSEEEEEE
FT                   EEEEE"
     MVGIMASYSR ARLKDLANSA KSATELPPKL QRLRYMRRDL QKDDSVFPTE LLPHLFDLLS        60
     DQFGAVRKFV AEILGEIGLK YVELIPEIVP LLIKSLEDET PAVARQVIAC GADLFRSTLE       120
     RVAVQGLHSS ELNDLLESSW TWLIKFKDEI CSVAFKQGNS GVKLCAMKFV EALILLYTPH       180
     EGIEADFNIS ILRGGHPVLK IGDLSIEASQ KLGLLLDQLR HPAAKSLNSS TIIVLINSLS       240
     SVAKKRPAYC GRILPVLLSL DPLSFLKGVY AAATNLALKT VFLSCLKCTH PAAAPWKDRL       300
     TSALKEIEGG GQAAKAKDLF YKTNGSIQDK DSVEDTKVSV EENPLCASSD VAESNLSRKR       360
     SGSEYNIDLN GDASDGKRAR ITPSVSEEST DGLNGNDGVS LPRVASTSTG PSDSRGVSDS       420
     GPAQQLVGLF GTLVSQGEKA IGSLEILISS ISADLLTDVV MANMHNIPPN CSSYADGTDE       480
     LVMNMCIVGS DAQIKYPPSF VAGVLSLSTA FPPIAALINP HNEDEEVYSV HVDQQMFPAE       540
     DARTPPGLLA TCDTSFPENE ESNTVSPQNV HYIGNRESGI PGLESSAQHD GSGALVTNVL       600
     SSTNVEAASK NQNASFSGKL LVDVIPSMSV DKLEEFSPKA VGTVASASQF VLPKISAPVV       660
     DLSDEEKDSL QKLVFLRIVE AYKQISMSGG SQLRFSLLAH LGVEFPSELD PWKILQEHVL       720
     SDYLNHEGHE LTVRVLYRLY GEAEAEQDFF SSTTAASAYE SFLLTVAEAL RDSFPPSDKS       780
     LSKLLGDSPH LPKSVLMLLE SFCCPGSGEV EKDLQHGDRV TQGLSAVWSL ILMRPGIRND       840
     CLNIALQSAV HHLEEIRMKA IRLVANKLYS LSFITEQIEE FAKDRLFSVV SDDCDKMDLD       900
     LKSPPNKPQH SISGMSMETP SEATSSSTSV TEAQRCLSLY FALCTKKHSL FVHVFSIYKN       960
     ASDPVKQAIH LQIPILVRTM GSSSELLKII ADPPSGSDNL LIQVLQTLTE GPTPSSELIL      1020
     TIRKLFDTRI KDVEILFPIL PFLPRDDVLR IFPHMVNLPM EKFQVALSRV LQGSSQSGPV      1080
     LSPSEALIAI HSIDPARDGI PLKQVTDACN TCFAQRQTFT QQVLAGVLNQ LVQQIPLPML      1140
     FMRTVLQAIG AFPALSDFIL EILSRLVSKQ IWKYPKLWVG FLKCTQTTQP QSYKVLLQLP      1200
     PLQLGNALTK IPALRAPLTA HASQPEIQSS LPRSTLAVLG LVPDSQGTQT SQVQANETQT      1260
     SQEQQQQQAS EPQQTSQSQQ VSVPLSHSQV DHQEPSQVVA SQSQSSPIGT VQSAMSQSQN      1320
     SPIDTGRSEM SQSQNSPIDT GRSEMSQSQN SPIDTGRSEM SQSQNSPIDT GRSEMSESQS      1380
     SPIGQSQSSP IGTGQSDMSQ TPQVSDSSAP EPTSHTRTSD PQASSQTLRD DDEKIDDTAT      1440
     SENEVTEIEK SKESSEEEEE EEEEEE                                           1466
//

If you have problems or comments...

PBIL Back to PBIL home page