(data stored in ACNUC13479 zone)

EMBL: CP002688.FER1

CP002688.FER1        Location/Qualifiers
FT   CDS             complement(join(228149..228183,228272..228335,
FT                   228429..228494,228590..228651,228753..228840,
FT                   228941..229001,229114..229197,229287..229594))
FT                   /codon_start=1
FT                   /gene="FER1"
FT                   /gene_synonym="ARABIDOPSIS THALIANA FERRETIN 1"
FT                   /gene_synonym="ATFER1"
FT                   /gene_synonym="ferretin 1"
FT                   /locus_tag="AT5G01600"
FT                   /product="ferretin 1"
FT                   /note="ferretin 1 (FER1); FUNCTIONS IN: ferric iron
FT                   binding, iron ion binding; INVOLVED IN: in 12 processes;
FT                   LOCATED IN: thylakoid, chloroplast thylakoid membrane,
FT                   chloroplast stroma, chloroplast, membrane; EXPRESSED IN: 25
FT                   plant structures; EXPRESSED DURING: 15 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Ferritin, N-terminal
FT                   (InterPro:IPR001519), Ferritin-related
FT                   (InterPro:IPR012347), Ferritin-like (InterPro:IPR009040),
FT                   Ferritin, conserved site (InterPro:IPR014034),
FT                   Ferritin/ribonucleotide reductase-like
FT                   (InterPro:IPR009078), Ferritin/Dps protein
FT                   (InterPro:IPR008331); BEST Arabidopsis thaliana protein
FT                   match is: ferritin 4 (TAIR:AT2G40300.1); Has 1807 Blast
FT                   hits to 1807 proteins in 277 species: Archae - 0; Bacteria
FT                   - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0;
FT                   Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q39101"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR014034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q39101"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP797874.1,INSD:EH979537.1,INSD:EL073210.1,
FT                   INSD:BP816148.1,INSD:AV794321.1,INSD:BP817364.1,
FT                   INSD:BP560425.1,INSD:BP860204.1,INSD:ES014884.1,
FT                   INSD:BP592920.1,INSD:AV538677.1,INSD:EH856702.1,
FT                   INSD:BP841146.1,INSD:ES194421.1,INSD:AV824748.1,
FT                   INSD:EL095908.1,INSD:ES192958.1,INSD:EG487886.1,
FT                   INSD:BP815895.1,INSD:ES067962.1,INSD:BP805663.1,
FT                   INSD:AV806232.1,INSD:T04388.1,INSD:BP566435.1,
FT                   INSD:BP831265.1,INSD:AV796351.1,INSD:CK121416.1,
FT                   INSD:BP822013.1,INSD:BP661563.1,INSD:AA597366.1,
FT                   INSD:BP856254.1,INSD:ES166090.1,INSD:CB252417.1,
FT                   INSD:EL194740.1,INSD:BP632283.1,INSD:BP662030.1,
FT                   INSD:DR269953.1,INSD:AV535334.1,INSD:AV805648.1,
FT                   INSD:AV562066.1,INSD:EH877560.1,INSD:AV813381.1,
FT                   INSD:ES079349.1,INSD:EL284016.1,INSD:BP819416.2,
FT                   INSD:EG470686.1,INSD:BP655311.1,INSD:AV798328.1,
FT                   INSD:EH836858.1,INSD:DR370128.1,INSD:AV564705.1,
FT                   INSD:ES209040.1,INSD:BP832154.1,INSD:AV562617.1,
FT                   INSD:EH930890.1,INSD:DR269956.1,INSD:AV535957.1,
FT                   INSD:BP585560.1,INSD:BP810361.1,INSD:AV538072.1,
FT                   INSD:EG499974.1,INSD:EL160307.1,INSD:EH934272.1,
FT                   INSD:BP654467.1,INSD:EL999105.1,INSD:BP806424.2,
FT                   INSD:BP580340.1,INSD:ES187020.1,INSD:EH960949.1,
FT                   INSD:AI997778.1,INSD:ES085762.1,INSD:EH881232.1,
FT                   INSD:BP560959.1,INSD:ES196236.1,INSD:BP810315.1,
FT                   INSD:BP834986.1,INSD:BE521679.1,INSD:EH970502.1,
FT                   INSD:CK119363.1,INSD:BP640954.1,INSD:BP827683.1,
FT                   INSD:EL301410.1,INSD:BP819095.1,INSD:BP662544.1,
FT                   INSD:AV811046.1,INSD:EL149555.1,INSD:EL026621.1,
FT                   INSD:BP626937.1,INSD:EG470683.1,INSD:BP590189.1,
FT                   INSD:BP859687.1,INSD:CB258647.1,INSD:ES017254.1,
FT                   INSD:BP609131.1,INSD:ES191511.1,INSD:EL330029.1,
FT                   INSD:CK121876.1,INSD:ES124115.1,INSD:BP625953.1,
FT                   INSD:EL329119.1,INSD:BP845929.1,INSD:BP646760.1,
FT                   INSD:ES006023.1,INSD:BP860612.1,INSD:AV560343.1,
FT                   INSD:BP825595.2,INSD:DR269950.1,INSD:BP563456.1,
FT                   INSD:EL307118.1,INSD:BP856220.1,INSD:BP820048.1,
FT                   INSD:BP609436.1,INSD:BP821859.1,INSD:ES025478.1,
FT                   INSD:BP600938.1,INSD:BP586770.1,INSD:BP625670.1,
FT                   INSD:BP846074.1,INSD:BP857184.1,INSD:EL975874.1,
FT                   INSD:BP635438.1,INSD:BP859791.1,INSD:BP826907.1,
FT                   INSD:CB255259.1,INSD:AV785072.1,INSD:AV794252.1,
FT                   INSD:BP816337.1,INSD:BP567509.1,INSD:EG525532.1,
FT                   INSD:BP817680.1,INSD:BP834387.1,INSD:AV807258.1,
FT                   INSD:BP613355.1,INSD:EL149543.1,INSD:BP809325.1,
FT                   INSD:ES213334.1,INSD:AV815665.1,INSD:EG490027.1,
FT                   INSD:Z18156.1,INSD:BP831465.1,INSD:ES083624.1,
FT                   INSD:EH882205.1,INSD:ES097901.1,INSD:EL074981.1,
FT                   INSD:BP669507.1,INSD:ES030295.1,INSD:DR269951.1,
FT                   INSD:BP849105.2,INSD:CK119275.1,INSD:EG499976.1,
FT                   INSD:BP641849.1,INSD:EH893147.1,INSD:EG490028.1,
FT                   INSD:AV781358.1,INSD:EG522002.1,INSD:BP619422.1,
FT                   INSD:BP608335.1,INSD:BP651772.1,INSD:EH929694.1,
FT                   INSD:BP668442.1,INSD:EH884615.1,INSD:BP622037.1,
FT                   INSD:BE521680.1,INSD:BE844770.1,INSD:EH817469.1,
FT                   INSD:EL197986.1,INSD:BP819314.1,INSD:EL967890.1,
FT                   INSD:AV550220.1,INSD:BP657921.1,INSD:BP573643.1,
FT                   INSD:BP858424.1,INSD:BP590721.1,INSD:ES057102.1,
FT                   INSD:DR269954.1,INSD:BP820380.1,INSD:DR269947.1,
FT                   INSD:AV814866.1,INSD:CB257060.1,INSD:EL128033.1,
FT                   INSD:AV564739.1,INSD:EL300525.1,INSD:ES200955.1,
FT                   INSD:ES046008.1,INSD:BP856389.1,INSD:BP788691.1,
FT                   INSD:CB258963.1,INSD:EG523356.1,INSD:AV562546.1,
FT                   INSD:T42999.1,INSD:EH994988.1,INSD:EL204684.1,
FT                   INSD:BP588596.1,INSD:BP862986.1,INSD:BP571556.1,
FT                   INSD:BP617314.1,INSD:AV520721.1,INSD:EH860758.1,
FT                   INSD:DR269949.1,INSD:EG522003.1,INSD:EL982599.1,
FT                   INSD:AV441450.1,INSD:BP840633.1,INSD:BP831821.1,
FT                   INSD:EG481093.1,INSD:ES134179.1,INSD:ES214042.1,
FT                   INSD:EL974389.1,INSD:EH847154.1,INSD:EL267021.1,
FT                   INSD:EH891317.1,INSD:EL989508.1,INSD:BP844218.1,
FT                   INSD:T42023.1,INSD:AV560198.1,INSD:H37125.1,
FT                   INSD:EL069379.1,INSD:ES033298.1,INSD:EG488074.1,
FT                   INSD:BP650949.1,INSD:BP583353.1,INSD:AV557595.1,
FT                   INSD:BP841312.1,INSD:EL080897.1,INSD:BP649234.1,
FT                   INSD:EH841385.1,INSD:BP596709.1,INSD:EL074366.1,
FT                   INSD:ES043863.1,INSD:EL980930.1,INSD:BP589913.1,
FT                   INSD:ES151513.1,INSD:EL026516.1,INSD:BP595619.1,
FT                   INSD:T75606.1,INSD:CK119920.1,INSD:AV815804.1,
FT                   INSD:BP566589.1,INSD:BP863563.1,INSD:R64909.1,
FT                   INSD:BP563108.1,INSD:BP601579.1,INSD:BP854231.1,
FT                   INSD:BP861167.1,INSD:BP816671.1,INSD:BP824349.1,
FT                   INSD:BP671952.1,INSD:EL981070.1,INSD:BP666940.1,
FT                   INSD:BP654472.1,INSD:EL998576.1,INSD:DR269952.1,
FT                   INSD:EL064157.1,INSD:CK118115.1,INSD:BP836002.1,
FT                   INSD:EL275290.1,INSD:R86990.1,INSD:EH993315.1,
FT                   INSD:ES171814.1,INSD:ES076814.1,INSD:ES049091.1,
FT                   INSD:BP806131.1,INSD:AV809712.1,INSD:EL172942.1,
FT                   INSD:BP568263.1,INSD:BP621116.1,INSD:BP845329.1,
FT                   INSD:EG448548.1,INSD:BP604364.1,INSD:ES137834.1,
FT                   INSD:ES210817.1,INSD:BP818903.1,INSD:BP810006.2,
FT                   INSD:ES009937.1,INSD:BP833966.1,INSD:ES208448.1,
FT                   INSD:EL282324.1,INSD:BP843402.1,INSD:EG455144.1,
FT                   INSD:CD531964.1,INSD:BP781865.1,INSD:EG488085.1,
FT                   INSD:AV534494.1,INSD:EH865880.1,INSD:EL243281.1,
FT                   INSD:CD532714.1,INSD:EG455143.1,INSD:EL099544.1,
FT                   INSD:EL974150.1,INSD:ES161600.1,INSD:BP641191.1,
FT                   INSD:BP638206.1,INSD:BP845747.2,INSD:DR269955.1,
FT                   INSD:BP592385.1,INSD:BP649103.1,INSD:EG525534.1,
FT                   INSD:BP651373.1,INSD:EL038973.1,INSD:EL183283.1,
FT                   INSD:T45167.1,INSD:BP651874.1,INSD:ES132107.1,
FT                   INSD:EG520919.1,INSD:BP622742.1,INSD:BP657885.1,
FT                   INSD:BP824396.1,INSD:BP841252.1,INSD:BP625567.1,
FT                   INSD:AV553061.1,INSD:BP846350.1,INSD:BP840866.1,
FT                   INSD:EG448546.1,INSD:AV811958.1,INSD:BP842200.1,
FT                   INSD:BP859857.1,INSD:BP861364.2,INSD:BP843027.1,
FT                   INSD:Z30743.1,INSD:BP825262.2,INSD:DR269944.1,
FT                   INSD:BP560619.1,INSD:AV804569.1,INSD:AV562570.1,
FT                   INSD:EL970554.1,INSD:BP614111.1,INSD:AV565909.1,
FT                   INSD:ES177293.1,INSD:EL299935.1,INSD:EL334094.1,
FT                   INSD:BP628068.1,INSD:EL187175.1,INSD:BP840744.1,
FT                   INSD:BP659304.1,INSD:BP836907.1,INSD:BP857235.1,
FT                   INSD:CB255822.1,INSD:EL097395.1,INSD:BP867524.1,
FT                   INSD:AV784079.1,INSD:BP824954.1,INSD:BP798558.1,
FT                   INSD:ES026608.1,INSD:EH897465.1,INSD:BP800471.1,
FT                   INSD:EL037899.1,INSD:EH821718.1,INSD:BP670484.1,
FT                   INSD:BP638989.1,INSD:BP826928.1,INSD:BP802108.1,
FT                   INSD:EH978118.1,INSD:BP669013.1,INSD:EL147017.1,
FT                   INSD:BP811040.1,INSD:AV531795.1,INSD:DR269945.1,
FT                   INSD:BP638289.1,INSD:CF652310.1,INSD:ES124554.1,
FT                   INSD:BP605648.1,INSD:AV823972.1,INSD:AB050569.1,
FT                   INSD:ES197536.1,INSD:BP818773.1,INSD:BP641643.1,
FT                   INSD:BP820902.1,INSD:ES072116.1,INSD:ES012217.1,
FT                   INSD:ES050601.1,INSD:BP640637.1,INSD:EG471925.1,
FT                   INSD:EL145369.1,INSD:ES014864.1,INSD:ES147814.1,
FT                   INSD:BP832274.1,INSD:BP805829.1,INSD:ES155601.1,
FT                   INSD:BP827447.1,INSD:EL968460.1,INSD:AV818210.1,
FT                   INSD:ES164286.1,INSD:BP812589.1,INSD:AV527160.1,
FT                   INSD:ES023308.1,INSD:BP605075.1,INSD:ES179658.1,
FT                   INSD:BP572945.1,INSD:BP638159.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF339691.1,INSD:AK220892.1,INSD:BX829583.1,
FT                   INSD:BX830797.1,INSD:BX841654.1,INSD:AY084509.1,
FT                   INSD:X94248.1,INSD:AF326869.1,INSD:AF412065.1,
FT                   INSD:AK226433.1"
FT                   /protein_id="AED90364.1"
FT                   /translation="MASNALSSFTAANPALSPKPLLPHGSASPSVSLGFSRKVGGGRAV
FT                   VVAAATVDTNNMPMTGVVFQPFEEVKKADLAIPITSHASLARQRFADASEAVINEQINV
FT                   EYNVSYVYHSMYAYFDRDNVAMKGLAKFFKESSEEERGHAEKFMEYQNQRGGRVKLHPI
FT                   VSPISEFEHAEKGDALYAMELALSLEKLTNEKLLNVHKVASENNDPQLADFVESEFLGE
FT                   QIEAIKKISDYITQLRMIGKGHGVWHFDQMLLN"
     MASNALSSFT AANPALSPKP LLPHGSASPS VSLGFSRKVG GGRAVVVAAA TVDTNNMPMT        60
     GVVFQPFEEV KKADLAIPIT SHASLARQRF ADASEAVINE QINVEYNVSY VYHSMYAYFD       120
     RDNVAMKGLA KFFKESSEEE RGHAEKFMEY QNQRGGRVKL HPIVSPISEF EHAEKGDALY       180
     AMELALSLEK LTNEKLLNVH KVASENNDPQ LADFVESEFL GEQIEAIKKI SDYITQLRMI       240
     GKGHGVWHFD QMLLN                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page