(data stored in ACNUC13479 zone)

EMBL: CP002688.FRB1

CP002688.FRB1        Location/Qualifiers
FT   CDS             complement(join(34872..35133,35219..35695,35787..36019,
FT                   36122..36254,36327..36415,36497..36567,36656..36725,
FT                   37196..37756))
FT                   /codon_start=1
FT                   /gene="FRB1"
FT                   /gene_synonym="F7J8.80"
FT                   /gene_synonym="F7J8_80"
FT                   /gene_synonym="FRIABLE 1"
FT                   /locus_tag="AT5G01100"
FT                   /product="O-fucosyltransferase family protein"
FT                   /note="O-fucosyltransferase family protein; CONTAINS
FT                   InterPro DOMAIN/s: GDP-fucose protein O-fucosyltransferase
FT                   (InterPro:IPR019378); BEST Arabidopsis thaliana protein
FT                   match is: O-fucosyltransferase family protein
FT                   (TAIR:AT3G54100.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LFC6"
FT                   /db_xref="InterPro:IPR019378"
FT                   /db_xref="InterPro:IPR024709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFC6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP577816.1,INSD:AU226934.1,INSD:BP574125.1,
FT                   INSD:EG503413.1,INSD:ES189896.1,INSD:ES193829.1,
FT                   INSD:EG496316.1,INSD:EL193772.1,INSD:BP803799.1,
FT                   INSD:EG503412.1,INSD:AU236118.1,INSD:BP581712.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT046173.1,INSD:AK228227.1,INSD:BX832511.1"
FT                   /protein_id="AED90299.1"
FT                   /translation="MSVGVPVNPSSSSQLPAAPTTTTRRRVADSQEDHSHVNTVGGGNA
FT                   VVYVPDEEETATSCCGGGGGGGSLSCCPSGSHHNYLVGFLSLRKFRLVWMLMVENKSKW
FT                   TAGIARNMRSTTNLGRFILTLLSILVVTFFLIVALSGGVGRRRKHVEKHEFVVSIHPRP
FT                   TIEKIIREDESSNSFQVLVPKTTSIPEIWNQPEVGNYQKCVARPKNQRPIKQTNGYLLV
FT                   HANGGLNQMRTGICDMVAIAKIMNATLVLPFLDHSSFWSDPSSFKDIFDWKHFIKVLAE
FT                   DVNIVEYLPQEFASIKPLEKNPVSWSKSSYYRNSISKLLKKHKVIVFNHTDSRLANNSP
FT                   PPSIQRLRCRANYEALRYSEDIENLSNVLSSRLRENNEPYLALHLRYEKDMLAFTGCNH
FT                   SLSNEESIDLEKMRFSIPHWKEKVINGTERRLEGNCPMTPREAAVFLKAMGFPSTTNIY
FT                   IVAGKIYGQNSMTAFHEEFPNVFFHNTLATEEELSTIKPYQNRLAALDYNLALESDIFA
FT                   YTYDGNMAKAVQGHRRFEGFRKTINPDRQRFVRLIDRLDAGLISWEDFSSKVKKMHQHR
FT                   IGAPYLRQPGKAGMSPKLEENFYANPLPGCVCDTSEEQTGLNRFERPSLRAQSLR"
     MSVGVPVNPS SSSQLPAAPT TTTRRRVADS QEDHSHVNTV GGGNAVVYVP DEEETATSCC        60
     GGGGGGGSLS CCPSGSHHNY LVGFLSLRKF RLVWMLMVEN KSKWTAGIAR NMRSTTNLGR       120
     FILTLLSILV VTFFLIVALS GGVGRRRKHV EKHEFVVSIH PRPTIEKIIR EDESSNSFQV       180
     LVPKTTSIPE IWNQPEVGNY QKCVARPKNQ RPIKQTNGYL LVHANGGLNQ MRTGICDMVA       240
     IAKIMNATLV LPFLDHSSFW SDPSSFKDIF DWKHFIKVLA EDVNIVEYLP QEFASIKPLE       300
     KNPVSWSKSS YYRNSISKLL KKHKVIVFNH TDSRLANNSP PPSIQRLRCR ANYEALRYSE       360
     DIENLSNVLS SRLRENNEPY LALHLRYEKD MLAFTGCNHS LSNEESIDLE KMRFSIPHWK       420
     EKVINGTERR LEGNCPMTPR EAAVFLKAMG FPSTTNIYIV AGKIYGQNSM TAFHEEFPNV       480
     FFHNTLATEE ELSTIKPYQN RLAALDYNLA LESDIFAYTY DGNMAKAVQG HRRFEGFRKT       540
     INPDRQRFVR LIDRLDAGLI SWEDFSSKVK KMHQHRIGAP YLRQPGKAGM SPKLEENFYA       600
     NPLPGCVCDT SEEQTGLNRF ERPSLRAQSL R                                      631
//

If you have problems or comments...

PBIL Back to PBIL home page